1RM6


Conserved Protein Domain Family
4hydrxCoA_A

?
TIGR03194: 4hydrxCoA_A 
Click on image for an interactive view with Cn3D
4-hydroxybenzoyl-CoA reductase, alpha subunit
This model represents the largest chain, alpha, of the enzyme 4-hydroxybenzoyl-CoA reductase. In species capable of degrading various aromatic compounds by way of benzoyl-CoA, this enzyme can convert 4-hydroxybenzoyl-CoA to benzoyl-CoA.
Statistics
?
PSSM-Id: 132238
View PSSM: TIGR03194
Aligned: 5 rows
Threshold Bit Score: 1302.49
Threshold Setting Gi: 499557071
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1RM6_A        15 TPLVDGVEKVTGKAKYTADIAAPDALVGRILRSPHAHARILAIDTSAAEALEGVIAVCTGAETP-VPFGVLPIAENEYPL 93  Thauera aromatica
O33819        15 TPLVDGVEKVTGKAKYTADIAAPDALVGRILRSPHAHARILAIDTSAAEALEGVIAVCTGAETP-VPFGVLPIAENEYPL 93  Thauera aromatica
WP_011156238  15 VPLVDGIDKVTGRARYTADLDHTGALVARILRSPISHGDIVRLDVSKALALDGVAAIVTGEDCA-ITYGVLPIAMNEYPM 93  Rhodopseudomona...
WP_004513069  12 VPRIDGPEKVTGAAKYTGDLKFPNMLYGKILTSPHAHARIISIDTSEAEKLPGVKAVITHKDVPeLKYGLSPARWDENIF 91  Geobacter metal...
WP_011237854  25 LPLIDGVEKVTGTARYTADLPAQGALVGKLLRSPYAHAELLEVDISEALKLPGVRGIVTGNDCD-TPYGVIPIAQNEFPL 103 Aromatoleum aro...
1RM6_A        94 ARDKVRYRGDPVAAVAAIDEVTAEKALALIKVDYEVLPAYMTPKAAMKAGAIALHDDKPNNILREVHAEFGDVAAAFAEA 173 Thauera aromatica
O33819        94 ARDKVRYRGDPVAAVAAIDEVTAEKALALIKVDYEVLPAYMTPKAAMKAGAIALHDDKPNNILREVHAEFGDVAAAFAEA 173 Thauera aromatica
WP_011156238  94 ARDRVRYRGEPVAAVAAVDAETARQALDLIELELRELPAYYESEAARAPDAWLLHDNKPGNIEREVHNEFGDLAAGFEAA 173 Rhodopseudomona...
WP_004513069  92 CIDKVRFVGDKVAAVACVDEDTCYRAMKLIKVEYEELPAVLDFRHAMDEGQPLVHEEYERNINTEIHQEFGDVAKALAEA 171 Geobacter metal...
WP_011237854 104 ARGRIRYVGEPVAAVAAVDEATTDAALALIRLKVRELPAYFDAADARKADVVLLHDNKKGNIEREVHNEFGDAAAGFAAA 183 Aromatoleum aro...
1RM6_A       174 DLIREKTYTFAEVNHVHMELNATLAEYDPVRDMLTLNTTTQVPYYVHLKVAACLQMDSARIRVIKPFLGGGFGARTEALH 253 Thauera aromatica
O33819       174 DLIREKTYTFAEVNHVHMELNATLAEYDPVRDMLTLNTTTQVPYYVHLKVAACLQMDSARIRVIKPFLGGGFGARTEGLH 253 Thauera aromatica
WP_011156238 174 DLIRTHTHHCAEVNHAQIEPHACLMDYDPVTGRLTAQSVSQVGYYLHLMLARCLEIDPSRVRVIKPFVGGGFGARVEVLN 253 Rhodopseudomona...
WP_004513069 172 HHVRTDVFVGQRTYQAPIEPHSAISMWEGEK--LTIYSSTQSPHYFQYYIAREFGMPMGDVRIIKPYLGGGFGGKLEPTG 249 Geobacter metal...
WP_011237854 184 DLICEETFECAEVHHAMMEPNASLAAWDNERGHLTLWSVTQVPYYVHESLARCMKLDAAYIRVIKPFVGGGFGHRVETLN 263 Aromatoleum aro...
1RM6_A       254 FEIIAGLLARKAKGTVRLLQTREETFIAHRGRPWTEVKMKIGLKKDGKIAALALEATQAGGAYAGYGIITILYTGALMHG 333 Thauera aromatica
O33819       254 FEIIAGLLARKAKGTVRLLQTREETFIAHRGRPWTEVKMKIGLKKDGKIAALALEATQAGGAYAGYGIITILYTGALMHG 333 Thauera aromatica
WP_011156238 254 FEVIAALLARKASGRVLMRLSREETFITHRARPQTDITLTIGTRRDGRFTACSCEVVQRGGAYAGYGIVTILYAGALLQG 333 Rhodopseudomona...
WP_004513069 250 LEFAGAVLAKRTGRPVRTFYDRAEMFAHNRGRHAQYMEITTGVDKDGKILAAKANFIMDGGAYTSLGIASAYYAGALLPM 329 Geobacter metal...
WP_011237854 264 FEIIAGLLARAARGTVRLLQTREEAFLTHRGRPQTYVRMKLGLTRDGRMTACEAEVVQRGGAYGGYGLVTILYAGALLNG 343 Aromatoleum aro...
1RM6_A       334 LYHIPAIKHDAWRVYTNTPPCGAMRGHGTVDTRAAFEALLTEMGEELGIDSLKIRQINMLpQIPYVTMYAQRVMSYGVPE 413 Thauera aromatica
O33819       334 LYHIPAIKHDAWRVYTNTPPCGAMRGHGTVDTRAAFEALLTEMGEELGIDSLKIRQINMLpQIPYVTMYAQRVMSYGVPE 413 Thauera aromatica
WP_011156238 334 LYDIPAVKYDGYRVYTNLPPCGAMRGHGSVDVRHAFENLVDRMARELGLDPFAVRRANLL-AAPTRTLNDLMVNSYGLAE 412 Rhodopseudomona...
WP_004513069 330 TYEFDNYQFDMFRVYTNLPACGAQRGHGAPQPKYAFESHLDNVAADLGIDPMDIRIRNAR-RPDTVTPNDFRVNSCMMRE 408 Geobacter metal...
WP_011237854 344 LYDLPAVKYDGYRVYTNTPPCGAMRGHGTVNIRFAFESLLDMMAAELGLDAFAVRRRNLL-KAPTETINGLKVMSYGLPE 422 Aromatoleum aro...
1RM6_A       414 CLEKVKAASGWEERKGKL------PKGRGLGIALSHFVSGTSTPKHWTGEPHATVNLKLDFDG-GITLLTGAADIGQGSN 486 Thauera aromatica
O33819       414 CLEKVKAASGWEERKGKL------PKGRGLGIALSHFVSGTSTPKHWTGEPHATVNLKLDFDG-GITLLTGAADIGQGSN 486 Thauera aromatica
WP_011156238 413 CLDKVERASGWHERIGRL------PPGKGLGMACSHYVSGSAKPIHFTGEPHAVVALRLDFDG-GITALTGAADIGQGSS 485 Rhodopseudomona...
WP_004513069 409 CLEQVRQISDWDEKKKNL------PHGRGIGVATGSFVTGAGYPIYRTDLPHAAAFIKVHEDGtAATLYTGSVDIGQGSD 482 Geobacter metal...
WP_011237854 423 CLDWVEQASGWRERAARLeansdgPIRRGIGIACSHFVSGSAKPVHFTGQPHATIALRVDFDA-GITILTGASDIGQGSS 501 Aromatoleum aro...
1RM6_A       487 TMASQVAAEVLGVRLSRIRVISADSALTPKDNGSYSSRVTFMVGNASISAAEELKGVLVKAAAKKLDAREEDIEVIDEMF 566 Thauera aromatica
O33819       487 TMASQVAAEVLGVRLSRIRVISADSALTPKDNGSYSSRVTFMVGNASISAAEELKGVLVKAAAKKLDAREEDIEVIDEMF 566 Thauera aromatica
WP_011156238 486 TVVAITVAETLGVALNRVRVISGDSAITPKDNGAYSSRITFMVGNAAIDAATKLKQILIAAAARKLEAVPEQIECAGESF 565 Rhodopseudomona...
WP_004513069 483 TILCQMAAEAMGYRYEQMKIVAADTEITPLDFGAYASRQTYMSGAAVKQAGEEVKKQLLDLASTMLSLPADDLECAEGVI 562 Geobacter metal...
WP_011237854 502 TIITQVVAEILGVEYRRLRLIATDSALTPKDNGSYSSRVTFMVGNAAADAARNLKAVLVAAAAKRLQVAEADVDWLGEAA 581 Aromatoleum aro...
1RM6_A       567 MVSGSQDPGLSFQEVVKAAMVDSGTITVKGTYTCPTEFQGDKKiRGSAIGATMGFCYAAQVVEASVDEITGKVTAHKVWV 646 Thauera aromatica
O33819       567 MVSGSQDPGLSFQEVVKAAMVDSGTITVKGTYTCPTEFQGDKKiRGSAIGATMGFCYAAQVVEASVDEITGKVTAHKVWV 646 Thauera aromatica
WP_011156238 566 FIGSGAQAALGFAEVVKAALVDEGAITVKGIFTCPPESQGGQH-RGGAVGSTMGFSYAAQVVEVSVDDATGLITVDKVWA 644 Rhodopseudomona...
WP_004513069 563 FSKSREGKTLTFEEVARKHFVLKGPLLGRGAYT-PPKL-GGSF-KGAAVGTSPAYSFGAQVGEVSIDEETGEITVVGIWD 639 Geobacter metal...
WP_011237854 582 AVVGDASRQIPFHDIVEEALVDVGMLTVKGTFTCPPEFQGGKQ-RGGAVGSTMGFSYAAQAVEVSVDTELGKVTVEKVWS 660 Aromatoleum aro...
1RM6_A       647 AVDVGKALNPLAVEGQTQGGVWMGMGQALSEETVYDN-GRMVHGNILDYRVPTIVESPDIEVIIVESMDPNGPFGAKEAS 725 Thauera aromatica
O33819       647 AVDVGKALNPLAVEGQTQGGVWMGMGQALSEETVYDN-GRMVHGNILDYRVPTIVESPDIEVIIVESMDPNGPFGAKEAS 725 Thauera aromatica
WP_011156238 645 ALDCGRAINPLAVVGQVQGAVWMGMGQAMCEETRYLD-GLPAHASFLEYRMPTMIESPPIEVAIVESVDPFGPFGAKEAS 723 Rhodopseudomona...
WP_004513069 640 VHDCGKVINPRLLHGQVHGALYMGMGESVWEEVLFDDkGRIKNAELANYRLLTAVDMPPIQSEVVNSYEPTGPWGVKEVG 719 Geobacter metal...
WP_011237854 661 AIDCGFAINPMSVEGQVQGAIWMGMGQAISEETVYEN-GRHKAVSLLDYRVPTIIESPDIAVHIVESLDPNGPFGAKEAS 739 Aromatoleum aro...
1RM6_A       726 EGMLAGFLPAIHEAVYEAVGVRATDFPLSPDRITELL 762 Thauera aromatica
O33819       726 EGMLAGFLPAIHEAVYEAVGVRATDFPLSPDRITELL 762 Thauera aromatica
WP_011156238 724 EGALAGFPPAMVNAVANAIGIDLDDLPATPDRVVEal 760 Rhodopseudomonas palustris
WP_004513069 720 EGATNPTLGMFSNAIFDAMGVRVNSLPLTYEKVWRAL 756 Geobacter metallireducens
WP_011237854 740 EGPLAGVMSAIAAAIEDATGTRIRATPFTPDRVFDAL 776 Aromatoleum aromaticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap