1RM6


Conserved Protein Domain Family
4hydroxCoAred

?
TIGR03193: 4hydroxCoAred 
Click on image for an interactive view with Cn3D
4-hydroxybenzoyl-CoA reductase, gamma subunit
4-hydroxybenzoyl-CoA reductase converts 4-hydroxybenzoyl-CoA to benzoyl-CoA, a common intermediate in the degradation of aromatic compounds. This protein family represents the gamma chain of this three-subunit enzyme.
Statistics
?
PSSM-Id: 132237
View PSSM: TIGR03193
Aligned: 5 rows
Threshold Bit Score: 261.735
Threshold Setting Gi: 13431531
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1RM6_C         4 ILRLTLNGRAREDLVPDNMLLLDYLRETVGLTGTKQGCDGGECGACTVLVDDRPRLACSTLAHQVAGKKVETVESLATQG 83  Thauera aromatica
WP_011501946  25 LLRLQVNGRWREDAVADGLLLVDYLRDVVGLTGVKSGCDGGECGACTVLIDGDPVPSCITLAVRCEDRHVETIEGLAGNG 104 Rhodopseudomona...
WP_011237855   4 LLTLSVNGRPREDAVAGNALLIDYLRDTLGLTGTKQGCDGGECGACTVLVDGQPRLACCTLAHSVAGHSIETIEGLSHEG 83  Aromatoleum aro...
WP_011156237  12 llglNVNGRWREDAVTDDMLLVDYLRDIAGLTGVKTGCDGGECGACTVLIDGEAAPSCLVLAVRCEGRYIETVEGLAANG 91  Rhodopseudomona...
O33818         4 ILRLTLNGRAREDLVPDNMLLLDYLRETVGLTGTKQGCDGGECGACTVLVDDRPRLACSTLAHQVAGKKVETVESLATQG 83  Thauera aromatica
1RM6_C        84 TLSKLQAAFHEKLGTQCGFCTPGMIMASEALLRKNPSPSRDEIKAALAGNLCRCTGYVKIIKSVETAA 151 Thauera aromatica
WP_011501946 105 RLNRLQQAFHERLGTQCGFCTPGMIMAAEGLLRRNPSPTEAEIRTALSGNLCRCTGYAKILESVQAAA 172 Rhodopseudomonas palustris
WP_011237855  84 NLSRLQRAFHEHLGSQCGFCTPGMIMAAEALLRRNPQPSRDEIRAALAGNLCRCTGYVKIIESVEAAA 151 Aromatoleum aromaticum
WP_011156237  92 RLHRLQQTFHERLGAQCGFCTPGMIMAAEGLLRRNPSPTDEEIRTALSGNLCRCTGYAKIVESVQAAA 159 Rhodopseudomonas palustris
O33818        84 TLSKLQAAFHEKLGTQCGFCTPGMIMASEALLRKNPSPSRDEIKAALAGNLCRCTGYVRSSKSVETAA 151 Thauera aromatica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap