Conserved Protein Domain Family
benz_CoA_bzdQ

?
TIGR03192: benz_CoA_bzdQ 
benzoyl-CoA reductase, bzd-type, Q subunit
Members of this family are the Q subunit of one of two related types of four-subunit ATP-dependent benzoyl-CoA reductase. This enzyme system catalyzes the dearomatization of benzoyl-CoA, a common intermediate in pathways for the degradation for a number of different aromatic compounds, such as phenol and toluene.
Statistics
?
PSSM-Id: 132236
View PSSM: TIGR03192
Aligned: 2 rows
Threshold Bit Score: 557.396
Threshold Setting Gi: 499555452
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAQ08809       6 AAATAAPEKKEFWRWQENTWFDETKNWKDAKIITCGIDVGSVSSQAVLVCDGELYGYNSMRTGNNSPDSAKNALQGIMDK 85  Azoarcus sp. CIB
WP_011236235   7 AAAATAPEKKEFWRWQENTVWDENKDWRDAKIITCGIDVGSVSSQAVLVCDGELYGYNSMRTGNNSPDSARNALQGIMDK 86  Aromatoleum aro...
AAQ08809      86 IGMKLEDINYVVGTGYGRVNVPFAHKAITEIACHARGANYMGGNKVRTILDMGGQDCKAIHCDEKGKVTNFLMNDKCAAG 165 Azoarcus sp. CIB
WP_011236235  87 IGMKLEDINYVVGTGYGRVNVPFAHKAITEIACHARGANYMGGNAVRTILDMGGQDCKAIHCDEKGKVTNFLMNDKCAAG 166 Aromatoleum aro...
AAQ08809     166 TGRGMEVISDLMQIPIAELGPRSFDVETEPEAVSSICVVFAKSEALGLLKAGYTKNMVIAAYCQAMAERVVSLLERIGVE 245 Azoarcus sp. CIB
WP_011236235 167 TGRGMEVISDLMQIPIADLGPRSFDVEVEPEAVSSICVVFAKSEALGLLKAGYTKNMVIAAYCQAMAERVVSLLERIGVE 246 Aromatoleum aro...
AAQ08809     246 EGFFITGGIAKNPGVVKRIERLLGIKQVETKIDSQIAGALGAALFGYTLMQKQ 298 Azoarcus sp. CIB
WP_011236235 247 EGFFITGGIAKNPGVVKRIERILGIKAVDTKVDSQIAGALGAALFGYTLMQKQ 299 Aromatoleum aromaticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap