Conserved Protein Domain Family
benz_CoA_bzdO

?
TIGR03191: benz_CoA_bzdO 
benzoyl-CoA reductase, bzd-type, O subunit
Members of this family are the O subunit of one of two related types of four-subunit ATP-dependent benzoyl-CoA reductase. This enzyme system catalyzes the dearomatization of benzoyl-CoA, a common intermediate in pathways for the degradation for a number of different aromatic compounds, such as phenol and toluene.
Statistics
?
PSSM-Id: 132235
View PSSM: TIGR03191
Aligned: 2 rows
Threshold Bit Score: 971.018
Threshold Setting Gi: 499558021
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011238804   8 YPTEPLKLWGKAKQLREQYYQNYARAKEKGGIRWSGSAWALDAIPAGLGEDVYSLTGEPYAAAVAHDRKFAKECMDAAEA 87  Aromatoleum aro...
WP_011236237   5 YPTEPLKLWGKAKQLREQYYQNFARAKDNGGIRWSAAGWSFDAIPTSLGDDVYPLTGEPYSAGVSLDRKFTQRCLDAAES 84  Aromatoleum aro...
WP_011238804  88 YGFARDLCSYMRIYWGGMHLNKYAFGGEFPKPDFVFQTQICCSHSKWYQHVAKEEKVPEFYLDVGVGPYRDMTDARLDYV 167 Aromatoleum aro...
WP_011236237  85 YGFARDMCSYMRIYWGSMHLDEYFYGGKWPTSDFIFQTQICCSHAKWYQHVSRTKKIPDFYVDVSVGAYKDLTSDSLDYV 164 Aromatoleum aro...
WP_011238804 168 ANQLHDGIEFVEKASGRKFDDELFIKAVKNEMRSTSRWADICALNKVKPAPLDEKTMYSLYVLCTLQKSSQWCADFMDEL 247 Aromatoleum aro...
WP_011236237 165 TSQLHDSIEFVEKATGRKCDDELLIRAIKNEMRSTARWAQICELQKAVPAPLDEKTMYSLYVLAILHKSSQWCADFYDEL 244 Aromatoleum aro...
WP_011238804 248 YEEVKDRVARGIAAVPNESVRLMTDTQPPWSFLKIFRYLETYGAVSIGSLYTFALEGIWEDKPDGSWGGRTLPWEKGIEI 327 Aromatoleum aro...
WP_011236237 245 YEEVKDRVARGIAAVPNERCRLMSDTQPPWPFLKIFRYLETYGAVSIGSLYTFGLEGTWEYKEDGSWGARTLPWEKGIEM 324 Aromatoleum aro...
WP_011238804 328 NDRATAVRLYADWNLSKPQWQHFYDPRIKSEMMLRIIREWQVDGVMLHLNRGCEGLSIGIMENRLAIAKAGIPVMTFEGN 407 Aromatoleum aro...
WP_011236237 325 NDRDTALRLYADWNLSKPLWQQFFDPSVKSEMMLNIARDWNVDGCMMHLNRGCEGLSVGIMENRQAIAKAGIPIMTYEGN 404 Aromatoleum aro...
WP_011238804 408 MGDEREFDEVRTQARVDAFMEQLGMRRQAA 437 Aromatoleum aromaticum
WP_011236237 405 MGDEREFDEVRTQARVDAFMEQLGLRRLAA 434 Aromatoleum aromaticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap