Conserved Protein Domain Family
benz_CoA_bzdN

?
TIGR03190: benz_CoA_bzdN 
benzoyl-CoA reductase, bzd-type, N subunit
Members of this family are the N subunit of one of two related types of four-subunit ATP-dependent benzoyl-CoA reductase. This enzyme system catalyzes the dearomatization of benzoyl-CoA, a common intermediate in pathways for the degradation for a number of different aromatic compounds, such as phenol and toluene.
Statistics
?
PSSM-Id: 132234
View PSSM: TIGR03190
Aligned: 3 rows
Threshold Bit Score: 826.204
Threshold Setting Gi: 499555455
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAQ08806       3 DGLFDQFKTWYEKRHDYARDWKVRTGGQVVATMCTYTPEELLIAAGMLPVRVLGAHEPQNVTEPHIFGMFCPFCRDSLAQ 82  Azoarcus sp. CIB
WP_011238803   3 DGLFDQFKTWYEKRHDYARDWKARTGGQVVATMCTYTAEELLIAAGMLPVRVLGAHEPQNVTEPHIFGMFCPFCRDSLAQ 82  Aromatoleum aro...
WP_011236238   3 DGLFDQFKEWYEKRHDYARAWKARTGGQVVATMCTYSPEELLIAFGMLPVRVLGAHEPQNVTEPHIFGMFCPFCRDSLAQ 82  Aromatoleum aro...
AAQ08806      83 GLLGRFDYAEGVTLTQSCIQYRQTFGSWRLHVPTVKWDYYVPMPNEVQSPHARKAHYEEVQAFRVFLQTLTGKEITDAML 162 Azoarcus sp. CIB
WP_011238803  83 GLLGRFDYAEGVTLTQSCIQYRQTFGSWRQHVPTVKWDYYVPMPNEVQSEHARKAHYAEIQSFRVFLQTLIGKEITDDML 162 Aromatoleum aro...
WP_011236238  83 GLLGRYDYAEGVTLTQSCIQYRQTYSSWRQNVPTVKWDYYVAMPNDVQSPHARKAHVAEVQRFRVFLQTLTGKEITDDML 162 Aromatoleum aro...
AAQ08806     163 SDALAVCDENRRLLRELYEYRKAADPKVTGVEALYASLTAQFIDKREHNEMLKKTLAALPNRKVERKTGARFMTIGSEND 242 Azoarcus sp. CIB
WP_011238803 163 RESLAVVDENRRLLRELFDYRKDANPKVTGVEAVYASLTAQFIDKREHNEMLKKVLAALPSRKVERQTGARFMTIGSEND 242 Aromatoleum aro...
WP_011236238 163 RDALAVCDENRRLLRQLFDYRKEADPKVTGVEALYASITAQFIDKREHNEQLKKVLAALPSRKVERKTGARFMTIGSEND 242 Aromatoleum aro...
AAQ08806     243 DIAFMGMVESVGATIVIDDQCSGSRYFWNASKPEGDVIKAIAERYCDRPACPTKDYPAHTRFDHVLGMAKEYNVEGAIFL 322 Azoarcus sp. CIB
WP_011238803 243 DIAFMAMVESVGATIVIDDQCSGTRYFWNESKPETDVIKAIADRYCDRPACPTKDYPVHTRYDHVLGLAKDYGVQGAIFL 322 Aromatoleum aro...
WP_011236238 243 DVAFMAMVESVGATIVIDDQCSGTRYFWNASKPGDDVIRAIAERYCDRPACPTKDYPVHTRYDHVLNLAKEYNVQGAIFL 322 Aromatoleum aro...
AAQ08806     323 QQKFCDPHEGDYPDLKRHLEENGIPTLFLEFDITNPIGPFRIRIEAFLETLSEEELF 379 Azoarcus sp. CIB
WP_011238803 323 QQKFCDPHEGDYPDLKRHLEANGIPTLFLEFDITNPIGPFRIRIEAFLETLSEEELF 379 Aromatoleum aromaticum
WP_011236238 323 QQKFCDPHEGDYPDLKRHLEANGVPTLFLEFDITNPIGPFRIRIEAMLETLSEEELF 379 Aromatoleum aromaticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap