Conserved Protein Domain Family
dienoyl_CoA_hyt

?
TIGR03189: dienoyl_CoA_hyt 
cyclohexa-1,5-dienecarbonyl-CoA hydratase
This enzyme, cyclohexa-1,5-dienecarbonyl-CoA hydratase, also called dienoyl-CoA hydratase, acts on the product of benzoyl-CoA reductase (EC 1.3.99.15). Benzoyl-CoA is a common intermediate in the degradation of many aromatic compounds, and this enzyme is part of an anaerobic pathway for dearomatization and degradation.
Statistics
?
PSSM-Id: 132233
View PSSM: TIGR03189
Aligned: 3 rows
Threshold Bit Score: 449.396
Threshold Setting Gi: 78223357
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O87873         8 LKVWLERDGSLLRLRLARPKANIVDAAMIAAMRQALGEHLQAPALRAVLLDAEGPHFSFGASVDEHMPDQCAQMLKSLHG 87  Thauera aromatica
YP_385104      6 LKVWLEKDGALLRLRLARPKANIVDAAMIAALQAALTEHLPSAKLRAVLLDAEGPHFSFGASVEEHMPESCAAMLQSLHA 85  Geobacter metal...
WP_011384541   9 LKVWKDREGKLLRLRLSRPKANIVDAEMIAALSAALGDAHEDSALRAVLIDHEGPHFSFGASVAEHMPDQCAAMLASLHK 88  Magnetospirillu...
O87873        88 LVREMLDSPVPILVALRGQCLGGGLEVAAAGNLLFAAPDAKFGQPEIRLGVFAPAASCLLPPRVGQACAEDLLWSGRSID 167 Thauera aromatica
YP_385104     86 LVIQMLESPVPVLVAVRGQCLGGGLEVVAAGNLIFAAPGAMLGQPEIKIGVFAPAASCLLPERIGKTASEDLLFSGRSIT 165 Geobacter metal...
WP_011384541  89 LVIAMVDFPLPILVAVRGQCLGGGLEVALAGHMMFVSPDAKLGQPEIVLGVFAPAASCLLPERMPRVAAEDLLYSGRSID 168 Magnetospirillu...
O87873       168 GAEGHRIGLIDVLAEDPEAAALRWFDEHIARLSASSLRFAVRAARCDSVPRIKQKLDTVEALYLEELMASHDAVEGLKAF 247 Thauera aromatica
YP_385104    166 AEEGFRIGLVTAVAEDPEQAAVAYFDEHLAGLSASSLRFAVRAARIGVLERTKTKIAAVEKLYLEELMATHDAVEGLNAF 245 Geobacter metal...
WP_011384541 169 GAEAARLGIANAVVDDPENAALAWFDNGPAKHSAASLRFAVKAARLGMNERVKAKIAEVEALYLNGLMATHDAVEGLNAF 248 Magnetospirillu...
O87873       248 LEKRSANWENR 258 Thauera aromatica
YP_385104    246 LGKRPAAWQDR 256 Geobacter metallireducens GS-15
WP_011384541 249 LEKRPALWEDR 259 Magnetospirillum magneticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap