Conserved Protein Domain Family
AKGDH_not_PDH

?
TIGR03186: AKGDH_not_PDH 
alpha-ketoglutarate dehydrogenase
Several bacterial species have a paralog to homodimeric form of the pyruvate dehydrogenase E1 component (see model TIGR00759), often encoded next to L-methionine gamma-lyase gene (mdeA). The member from a strain of Pseudomonas putida was shown to act on alpha-ketobutyrate, which is produced by MdeA.This model serves as an exception model to TIGR00759, as other proteins hitting TIGR00759 should be identified as the pyruvate dehydrogenase E1 component.
Statistics
?
PSSM-Id: 132230
View PSSM: TIGR03186
Aligned: 5 rows
Threshold Bit Score: 1595.3
Threshold Setting Gi: 2217946
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAA20554      12 GVPGDSDPGETAEWLEALESTLAHCGPARARFLLEQLEAHARELGLERGAQPYSAYRNTLSLEHQGAYPGDLELDERITS 91  Pseudomonas putida
WP_011548539  16 QTKVDDDPLETAEWLDALDGVVRHAGAERAQYLFDRLAAHASSNGIATARLNVTPYVNTIAVAQQPPYPGDFDIEEKLAA 95  Burkholderia ce...
WP_004187349  16 RRHDDTDPQETAEWLDALDGVVAHAGAERAQYLLAQLAEHAARRRLAPPHAGATPYVNTIPVDEEPPYPGDLQLEERLAA 95  Burkholderia ma...
WP_010926927  11 PQIPDPDPVETAEWREALDSLTQAGGPERAAYVLQQLLARATALGVRAPGITRTAYLNTIAADQEPPFPGNLSLEERIAS 90  Bordetella bron...
WP_011400980  16 RRHDDTDPQETAEWLDALDGVVAHAGAERAQYLLAQLAEHAARRRLAPPPAGATPYVNTIPVDEELPYPGDPQLEERLAA 95  Burkholderia th...
BAA20554      92 ILRWNALAMVVRANHAYGDLGGHIASYASAAEIFEVGFQHFFRGEEGGEQrtADLVFFQPHSAPGIYARAFLEGRLSEAQ 171 Pseudomonas putida
WP_011548539  96 ALRWNALAMVVRANRAYGELGGHIAGYASAADLFEVGFNHFFRGANDANG--GDLVYFQPHSAPGVYARAYLEGFLDEAH 173 Burkholderia ce...
WP_004187349  96 VLRWNALAMVVRANRAYGELGGHIASYASAADLFEVGFNHFFRAAGDASG--GDLVYFQPHSSPGVYARAFLEGFLSDAQ 173 Burkholderia ma...
WP_010926927  91 INRWNALAMVVRANQAHGELGGHIASYASAADLFEVGFNHFFRAPAPGFG--GDLVYMQPHSAPGIYARAYLEGFLNDVD 168 Bordetella bron...
WP_011400980  96 VLRWNALAMVVRANRAYGELGGHIASYASAADLFEVGFNHFFRAAGDASG--GDLVYFQPHSSPGVYARAFLEGFLSDAQ 173 Burkholderia th...
BAA20554     172 LASYRQEVAG-----DGLCSYPHPWLMPDFWQFPTGSMGIGPLNAVYQARFMRYLQHR--AWPYRAHVWGVFGDGEMDEP 244 Pseudomonas putida
WP_011548539 174 LEHYRQEITG-----AGLCSYPHPWLMPDFWQFPTGSMGIGPINSIYQARFMRYLQNRglQRTEGRKVWGYFGDGEMDEP 248 Burkholderia ce...
WP_004187349 174 LEHYRREIAG-----PGLCSYPHPWLMPDFWQFPTGSMGIGPINAIYQARFMRYLQNRglLRTEGRKVWGFFGDGEMDEP 248 Burkholderia ma...
WP_010926927 169 LAHFRQEITAgaqglRGLSSYPHPWLMPDFWQFPTGSMGIGPINAIYQARFMRYLEHRslAMPSDRKVWGIFGDGEMDEP 248 Bordetella bron...
WP_011400980 174 LDHYRREIAG-----PGLCSYPHPWLMPDFWQFPTGSMGIGPINAIYQARFMRYLQNRglLRTDGRKVWGFFGDGEMDEP 248 Burkholderia th...
BAA20554     245 ESIAGLTLAARKQLDNLTFIVNCNLQRLDGPVRGNGQIIQELESLFSGAGWNVIKVLWGSEWDALFARDSEHVLLRQLAA 324 Pseudomonas putida
WP_011548539 249 EAIGALSLAARERLDNLVFVINCNLQRLDGPVRSNGRIIDELEAQFTGAGWNVIKVLWGSDWDPLFARDRSGALLRAFAH 328 Burkholderia ce...
WP_004187349 249 ESIGALSLAAREGLDNLVFVINCNLQRLDGPVRGNGRIVDELESQFAGAGWNVIKVLWGSDWDALFARDATGALARAFAQ 328 Burkholderia ma...
WP_010926927 249 ESIAALTLAARERLDNLVFVINCNLQRLDGPVRGNGRIIDELETLYAGAGWNVIKLVWGGDWDALLRRDPDGVLAGTFSH 328 Bordetella bron...
WP_011400980 249 ESIGALSLAAREGLDNLVFVINCNLQRLDGPVRGNGRIVDELESQFAGAGWNVIKVLWGSDWDALFARDATGALARAFAQ 328 Burkholderia th...
BAA20554     325 TPDGQFQTLGANDGAYNLEHFFNQHPALQRLVEHMSSAEINALNAGGHDFRKLYAAFAAAKACKGRPTVILAKTKKGYGM 404 Pseudomonas putida
WP_011548539 329 TVDGQFQTFSANDGAYNRDRFFGQNAELAALAAHLSNDDIDRLRRGGHDVRKLHAAYDKASKHSGQPTVILAKTMKGFGM 408 Burkholderia ce...
WP_004187349 329 TVDGQFQTFSANDGAYNRARFFGQNDALAALVAHLRDEDIDRLRRGGHDARKLYAAYERAVRHEGRPTVILAKTMKGFGL 408 Burkholderia ma...
WP_010926927 329 TVDGQFQTFAANDGAYNRQHFFGQDPRLSALVADWSDEAIDRLRRGGHDMVKIHAAYHRATHHRGQPTVILAQTKKGFGM 408 Bordetella bron...
WP_011400980 329 TVDGQFQTFSANDGAYNRARFFGQDDALAALVAHLRDEDIDRLRRGGHDARKLYAAYDRAVRHEGRPTVILAKTMKGFGM 408 Burkholderia th...
BAA20554     405 SAAGESRMTAHQAKKLDVQALLAFRDRFHLPLSDAQVEQLQFYRPDENSREMRYLRERRNGLGGSLPSRRPQAR-TLPVP 483 Pseudomonas putida
WP_011548539 409 GSIGQGRMTTHQQKKLDIEQLKAFRDRFRLPLSDDDVEQLKFYKPDESSAVMQYLHARRAALGGYLPRRRTAAShAPAVP 488 Burkholderia ce...
WP_004187349 409 GAIGQGRMTTHQQKKLDVEHLLAFRDRFRLPLTDEDVAQLRFYRPEKDSPEMRYLHARRAALGGCLPRRRAAATaALTVP 488 Burkholderia ma...
WP_010926927 409 GTAGQGKMTTHQQKKLDDEALLAFRDRFALPISDADCLALKFYKPAEDSAELRYLESRRAALGGYLPRRRTEAP-RLAPP 487 Bordetella bron...
WP_011400980 409 GAIGQGRMTTHQQKKLDVEHLLAFRDRFRLPLTDDDVAQLRFHKPAEDSPEMRYLHARRAALGGCLPRRRTAATtALTVP 488 Burkholderia th...
BAA20554     484 ALEVMGGFALHAEGKEMSTTMAAVRMLGAWLKAPELGPRVVPIVADEARTFGMASLFRQIGIYSPHGQRYEPEDASSLLS 563 Pseudomonas putida
WP_011548539 489 AMSSWGRFALDTNDKEMSTTMAFVRMLGNLLKDAELGPRVVPVVADEARTFGMANLFRQIGIYSPLGQLYEPEDMGSMLY 568 Burkholderia ce...
WP_004187349 489 SLPSWGQFALDG-GREMSTTMAIVRMLGGLLKDAALGPRIVPIVADEARTFGMANLFRQVGIYSPLGQRYEPEDLGSMLY 567 Burkholderia ma...
WP_010926927 488 PVADWARFALQAAGKEMSSTMAIVRMLTALLKDPQLGPRIVPIVADEARTFGMANLFRQVGIYSAQGQLYEPEDIGSVLA 567 Bordetella bron...
WP_011400980 489 SLPSWGQFALDG-GREMSTTTAIVRMLGGLLKDATLGPRIVPVVADEARTFGMANLFRQVGIYSPLGQRYEPEDLGSMLY 567 Burkholderia th...
BAA20554     564 YRESRDGQLLEEGITEAGALSSWVAAATSYAVHGEPMLPVYIYYSMFGFQRVGDLIWAAADQRARGLLLGATAGRTTLGG 643 Pseudomonas putida
WP_011548539 569 YREDTGGQILEEGISEAGAVSSWIAAATSYSVHDLTMLPFYIYYSMFGFQRIGDLIWAAADQRARGFLIGATAGKTTLGG 648 Burkholderia ce...
WP_004187349 568 YREDTRGQILEEGISEAGAISSWIAAATSYSVHDLPMLPFYIYYSMFGFQRIGDLIWAAADQRARGFLIGATSGKTTLGG 647 Burkholderia ma...
WP_010926927 568 YREARDGQILEEGITEAGAISSWTAAGTSYSVNGLPMLPFYIYYSMFGFQRIGDLIWAAADQRTRGFLIGATSGRTTLGG 647 Bordetella bron...
WP_011400980 568 YREDTRGQILEEGISEAGAMSSWIAAATSYSVHDLPMLPFYIYYSMFGFQRIGDLIWAAADQRARGFLIGATSGKTTLGG 647 Burkholderia th...
BAA20554     644 EGLQHQDGSSLVMAAMVPNCRAWEPCFAGRLAVILEHAARRMLVEQCDEFHYVAVMNESYPHPSLPPEAHAAVLRGMYR- 722 Pseudomonas putida
WP_011548539 649 EGLQHQDGTSHLAASTIPNCRAYDPAFAYEVAMIVDEGMQEMIARQRDVFYYMTVTNENYAQRSLTEADLDRVRSGVLKg 728 Burkholderia ce...
WP_004187349 648 EGLQHQDGTSHLAASTVPNCRAWDPAFAYEIAVIVDEGMREMVERQRDTFYYLTVTNENHAQPTLPADRLDAVRGGILKg 727 Burkholderia ma...
WP_010926927 648 EGLQHQDGYSHLAAAAVPNCRAYDPAYAYEVAVLVEHGMQRMLDEQCDEFYYLTVTNENLAQPDMPEG--EETRTGILRg 725 Bordetella bron...
WP_011400980 648 EGLQHQDGTSHVAASTVPNCRAWDPAFAYEVAVIVDEGMREMVERQRDTFYYLTVTNENYAQPPLPADRLDAVRDGILKg 727 Burkholderia th...
BAA20554     723 -FAEQPVEHALGRVRLLGSGAILREVIAASELLAADWGIASEVFSVTSFSELARDARDVQRGQRLG-------------- 787 Pseudomonas putida
WP_011548539 729 mYVLEPAQIEIAQVQLLGSGAILGEVQAAARMLKDDWNIDAAVWSVTSFTELHRDGVSAERAQRLLdh------------ 796 Burkholderia ce...
WP_004187349 728 mYPLDAAALPAARVQLLGSGAILGEVQAAARLLRDDWRIDAAVWSVTSFTELQRDGIAAERAQRLFdadd---------a 798 Burkholderia ma...
WP_010926927 726 mHRVR-AADATPQVRLLGAGPMLDEAMRAAQLLRDEHGVDAEVWSVTSFSELARGGRGAERAQALGl------------- 791 Bordetella bron...
WP_011400980 728 mYPLDAAALPAARVQLLGSGAILGEVQAAAHLLRDDWRIDAAVWSVTSFTELQRDGIAAERARRLFgaddaadaddaada 807 Burkholderia th...
BAA20554     788 --LGGSSHVAQCLVG-DAPVIAATDYVRAWPQLIAEYVPAPYVTLGTDGFGRSDTRQRLRQFFEVDRFSVVLASLQALVD 864 Pseudomonas putida
WP_011548539 797 -gEPAVPYVTAALGAaRGPVIAATDYVRAVPELIRAYVPSRYVVLGTDGFGRSDTRAALRAFFEVDRASIVIAALKALVD 875 Burkholderia ce...
WP_004187349 799 neRSPTPHVTSALAAtQGPVIAATDYARALPELIRAYVPRRYVTLGTDGFGRSDTREALRAFFEVDRGSIVIAALRALAD 878 Burkholderia ma...
WP_010926927 792 -pCPDGNWLAQCLGDqATPVVAVSDYVRAVPEQIRAWVPGPYRVLGTDGFGRSDTRARLRDFFEVGAPWIVLHALDLLAR 870 Bordetella bron...
WP_011400980 808 neRAPAPYVASALAAtQGPVIAATDYARALPELIRAFVPRRYVTLGTDGFGRSDTRQALRAFFEVDRASIAIAALQALAD 887 Burkholderia th...
BAA20554     865 DGLLEVDVMAQARARYP--ALDAAGPWYR 891 Pseudomonas putida
WP_011548539 876 EGRQDPDVVRQAIDRYGrsGTGLTEPWLV 904 Burkholderia cenocepacia
WP_004187349 879 DGEVTRTVVRDAIARYGkrDASRTPPWER 907 Burkholderia mallei
WP_010926927 871 EDS-AWQPALQARREQLqaATRNVPSWQS 898 Bordetella bronchiseptica
WP_011400980 888 DGVVARAVVRDAIVRYGkqDASRAPPWER 916 Burkholderia thailandensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap