Conserved Protein Domain Family
DNA_S_dndC

?
TIGR03183: DNA_S_dndC 
putative sulfurtransferase DndC
Members of this protein family are the DndC protein from the dnd (degradation during electrophoresis) operon. The dnd phenotype reflects a sulfur-containing modification to DNA. This operon is sparsely and sporadically distributed among bactera; among the first eight examples are members from the Actinobacteria, Firmicutes, Gammaproteobacteria, Cyanobacteria. DndC is suggested to be a sulfurtransferase. [DNA metabolism, Restriction/modification]
Statistics
?
PSSM-Id: 163177
View PSSM: TIGR03183
Aligned: 8 rows
Threshold Bit Score: 692.248
Threshold Setting Gi: 446856576
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011329737  25 SIKHIKMLYQSDSIPWVIGYSGGKDSTAILQLIWYALQELAQEGKcEKKVHVISTDTLVENPIVAMWVGKSLERMKEQAD 104 Pseudoalteromon...
WP_010999043  27 LTTEIQELYCLDAIPWVVGYSGGKDSTATLQLVWNAISSLPPERR-NKTIYVITTDTLVENPIVATWVRNSLKEMTVAAK 105 Nostoc sp. PCC ...
WP_010984363  30 LTEEIRELYTADQVPWVIGYSGGKDSTAVLQLVWMALKGLPAEQR-TKAVHVISTDTLVENPVVAAWVSASLGTMQDAAQ 108 Streptomyces av...
WP_011318994  27 LTTEIQELYCLDEIPWIIGVSWGKDSSTVLQLVWNAIAALPPDKR-TKTIHVITTDTKVENPIVSAWVRQSMKQLESAAQ 105 Anabaena variab...
WP_015898228  24 LAENVQALYLSDEIPWVVGYSGGKDSTATLQLIWTAIAALPAEKR-TKVIHVISTDTLVENPIIAGWVNASLLTMQRSAS 102 Acidobacterium ...
WP_011332374   8 IIAEIQTLYSSDSLPWIVGYSGGKDSTASLQLIWKAVAALPSEQR-TKEIHVISTDTLVENPVIAAWVQSSLARMKVEAD 86  Pseudomonas flu...
WP_011400708  28 LILEIQSLYLENDKPWVIGFSGGKDSTTVLSLIYVALTGLPEAKR-HKHIYVISSDTLVETPMVVDMINDSIEAINRNAQ 106 Hahella chejuensis
WP_000933832  20 AKEHIKKVYRADDRPWVVGYSGGKDSTVVVQLVFEALSELPTEQL-HKKVYVISSDTLVETPLIIQSINVTLHRIQEEAL 98  Bacillus cereus
WP_011329737 105 AQGLPIVPHRLTPAVKDRFWVNLIGKGYPAPRYKFRWCTDRLKISPSNTFIQNMADKNGEAILVLGTRKAESTARAASME 184 Pseudoalteromon...
WP_010999043 106 KQGMPVEPHLLQPEIKETFWVSLIGKGYPAPKGKFRWCTDRLKIHPSNRFIRDVVRAKGEVILVLGTRKNESVKRAISME 185 Nostoc sp. PCC ...
WP_010984363 109 AQGLPVEPHRLTPEIKDTFWVNLLGRGYPAPRPKFRWCTERLKIKPSNAFIRSVVAAHGEAIMVLGIRKTESQARARAME 188 Streptomyces av...
WP_011318994 106 EKGMPISPHLLQPVIEDTFWVNLIGKGYPAPRNQFRWCTPRLKINPANQFIRQIVRTNGETILVLGTRKAESTKRAATMK 185 Anabaena variab...
WP_015898228 103 DQDLPFRPNRLLPELKDRFWVNMIGRGYPAPRPKFRWCTERLKINPSNNFIRNVVDDAGEVILALGTRKAESQVRSASID 182 Acidobacterium ...
WP_011332374  87 RQGLPIRPHRLTPSIEHRFWVNLIGKGYPAPRNRFRWCTDRLKISASTKFIQELSEANSEAILVLGQRRGESQARDKVLD 166 Pseudomonas flu...
WP_011400708 107 DKKLPISAHVVYPAWNETFWVNLLGKGYPAPTQNFRWCTERMKIDPVSTFIKDKIARFGEVIVVLGARSQESSSRAQVIA 186 Hahella chejuensis
WP_000933832  99 KRDLPIETHKVKPKYEQSFWANIIGKGYPSPNQQFRWCTDRLKIEPANAFVMDKVSTFGEVIMVLGVRENESATRDNVLK 178 Bacillus cereus
WP_011329737 185 RF--ESSttNTRKALGltEN-----------G--SLERVWVYTPIASWSNDDVWVYLNSVDNPWNFPNHDLMGMYQGATE 249 Pseudoalteromon...
WP_010999043 186 KH--QAG--SLRERLN--SNlissksllynsA--SLPNSFIYSPLEDWRTDEVWIYLNQWQNPWGYNNKDLFSMYRGATA 257 Nostoc sp. PCC ...
WP_010984363 189 KH--EKR--RVRDRLS--PN-----------A--NLPNSLVYSPVEDWTNDDVWEFLMQKPNPWGYTNQDLLTMYQGASS 249 Streptomyces av...
WP_011318994 186 KH--QAG--RVRDRLS--PN-----------A--SLPNSLIYTPIEDWSNNEVWIYLNQCENPWGKSNKELFNLYRGATA 246 Anabaena variab...
WP_015898228 183 HY---SK--NARAGLQ--RH-----------G--QLDRSWVFSPIVDWSNDDVWQYLMQVKNPWGIDNKDLLGMYQGATE 242 Acidobacterium ...
WP_011332374 167 HY---SG--STRDRLS--RN-----------SdpKLSRVWVYLPIETWTSDDVWMYVLTDENPWGIDNQDLFDIYKGATP 228 Pseudomonas flu...
WP_011400708 187 KHkiEGS--S----LS--RH-----------S--SLPGAFTYMPIEDWTFDEVWMYLLGAPAPWGGDHFELFELYKDSSA 245 Hahella chejuensis
WP_000933832 179 SHtvEGK--DLM------RH-----------S--TLTNAYVFAPIRQFSLNNVWDYLLENPSPWGNDNHELNKLYQDSSS 237 Bacillus cereus
WP_011329737 250 GGECPLVVDK----STQSCGDSRFGCYVCTMVSEDKSMNAMIANDDEKEWMYPLVALRNeievndsnrakKIEk------ 319 Pseudoalteromon...
WP_010999043 258 DNECPLVVDT----STPSCGDSRFGCWVCTIVNKDKSMEAMIQNDEEKEWMQPLLDIRN-----------ELD------- 315 Nostoc sp. PCC ...
WP_010984363 250 DGECPLVVDS----TTPSCGSSRFGCWTCTLVDEDKSMSAMIQNDEEKEWMTPLLELRN-----------KLDapfdewk 314 Streptomyces av...
WP_011318994 247 DNECPLVIDT----STPSCGDSRFGCWVCTLVSQDKSMQAMIQNDEEKQWMQPLLDLRN-----------KLDa------ 305 Anabaena variab...
WP_015898228 243 DGECPLVVDT----STPSCGDSRFGCYVCTMVTEDKSMRSMIANDSDKAWMLPLLQFRN-----------QYLg------ 301 Acidobacterium ...
WP_011332374 229 DAECPVVVDK----STPSCGDSRFGCYVCTMVSQDKSMHAMIQNDDQKSWMKPILDYRN-----------TYLs------ 287 Pseudomonas flu...
WP_011400708 246 -GECPLVIDT----NTPSCGNSRFGCWTCTVVTKDRAIEGLI--DSGEVWLKKLKSFRN-----------KLFkt----- 302 Hahella chejuensis
WP_000933832 238 -GECPLVVDKtikeSAGSCGNSRFGCWVCTVVNEDKALNGFIL--SGSDWMKPLLEFRN-----------WLAg------ 297 Bacillus cereus
WP_011329737 320 -------------LTRDKANRDFRRMNGNLTVHIS----KHGADL--VPGPYIQKFREHLLG---------KVLEAQLAV 371 Pseudoalteromon...
WP_010999043 316 -------------NENDQDKRDFRRLRGEVQLVERhkdgETRVEP--IYGPYTKDSREYWLK---------RLLEAQTYI 371 Nostoc sp. PCC ...
WP_010984363 315 egeeipagrkvgdPKPDKPARDFRRMNGKVMLFKD--------DA--IHGPYLQSFREEWLK---------DLLDAQTWI 375 Streptomyces av...
WP_011318994 306 -------------KDDRDKRDF-RRIWGDVQLFERnkngKTSVEP--IPGPYTKYWRESWLK---------ELLEAQTKI 360 Anabaena variab...
WP_015898228 302 -------------NLNDRNVREFKRLNGSLMVHND--------RL--VHGPYTQSYRVNMLR---------ALLETQLTV 349 Acidobacterium ...
WP_011332374 288 -------------I-QDWDKRDFKRMNGRVKIMGK----GETSEL--IHGPYLQSYRAKLLE---------ELLRTQLTL 338 Pseudomonas flu...
WP_011400708 303 -----------tlPENKNEYRNFKRRTGRIQYARGaidnDNIAEIktIPGPYLLEYRKQWLK---------ELL----TI 358 Hahella chejuensis
WP_000933832 298 -------------IRDDRTFRMKYRKGGQIYFNPLktevKDDIEY--VIIPKKSSRPKQMIKleeftilerDELKSYLAI 362 Bacillus cereus
WP_011329737 372 QQ----------------------------------------------LGPDEVKNLELLPLEDLEEIRRIWLEEKHE-- 403 Pseudoalteromon...
WP_010999043 372 RR----------------------------------------------TAPENMRDITLISLEELSEIRRIWLEEKHE-- 403 Nostoc sp. PCC ...
WP_010984363 376 RA----------------------------------------------HAPEHVQNIELITLEELHEIRRIWVFDKHE-- 407 Streptomyces av...
WP_011318994 361 RR----------------------------------------------TAPEDMRDITLISLEELSEIRRIWLEEKHE-- 392 Anabaena variab...
WP_015898228 350 NK----------------------------------------------HLPKGIDSLELITIEELREIRRIWIEDKHE-- 381 Acidobacterium ...
WP_011332374 339 RN----------------------------------------------AKIPGHDQIELISIEEIDAIRRIWVEEKGE-- 370 Pseudomonas flu...
WP_011400708 359 EK----------------------------------------------NLIEEGRKIQLIHPEELHAIRKEWMFDPNEpd 392 Hahella chejuensis
WP_000933832 363 NNidlsspedpkilvkldnnqigqlglgpftlnarkeilrrllivqrdLQHPEEEDFELIKEEELRVIRRYWL-ENGD-- 439 Bacillus cereus
WP_011329737 404 AEDSVPKIYQNVFKKPYPG-KQRAHHPILNLDVLNKLKAHCqeqgDE-----DGLLYQQMRAVMSIANKHKNQLRRAKLS 477 Pseudoalteromon...
WP_010999043 404 FDDSLPRIYQEITGEEFKDpRPGADLSLLGSDEWSVLEEIC----AG-----DGMHLELMAKLLDTERQYRKMSRRVGIY 474 Nostoc sp. PCC ...
WP_010984363 408 VEDSLPRIYQEATGESFPG-GPLDEQLVMGSDEMDVLKQVC----DG-----DDLHYNMVRELLAVERKYRTMARRSGLF 477 Streptomyces av...
WP_011318994 393 FDDSLPRIYQEVTGEEFKDpRPGADLSLLGSDEWSVLEEIC----AG-----DGMHLELVAKLLDTERQYRKMSRRIGIY 463 Anabaena variab...
WP_015898228 382 VEDLLPAVYEDTLKRPFSA-NSVSVVPLLRTSEIETLREIS----DGqt-veSRLHYELLRELITTQAVSKSTHSRAKLL 455 Acidobacterium ...
WP_011332374 371 IEDLVPKIYERVLQQSYPG-QAMEQHP-LEPEDLALLNDVA----NEvdseaGGRLYQLARNLLAVQYQSMQSQKRSHHL 444 Pseudomonas flu...
WP_011400708 393 WSDELPKIYHSVYGEDL-D-WVEHDSGAFSQADADLIAELS----AE-----NGVPAELVMKLLELELSMDGLSRRKGLF 461 Hahella chejuensis
WP_000933832 440 WEDSLPSIFKEVMGYDLN--WEYDDRPLFDNEQITDLESLC----SK-----HNVDFKALKKLISLEKDFSGYKVRRGLM 508 Bacillus cereus
WP_011329737 478 DELTQSLDKG 487 Pseudoalteromonas haloplanktis
WP_010999043 475 ETLEKCFATS 484 Nostoc sp. PCC 7120
WP_010984363 478 QALEQAVQKG 487 Streptomyces avermitilis
WP_011318994 464 ETLEQCFTTS 473 Anabaena variabilis
WP_015898228 456 DELDRVLERS 465 Acidobacterium capsulatum
WP_011332374 445 DRLEEVLKAN 454 Pseudomonas fluorescens
WP_011400708 462 NKIENLLKND 471 Hahella chejuensis
WP_000933832 509 NEIEKVLKQD 518 Bacillus cereus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap