3E74


Conserved Protein Domain Family
allantoinase

?
TIGR03178: allantoinase 
Click on image for an interactive view with Cn3D
allantoinase
This enzyme carries out the first step in the degradation of allantoin, a ring-opening hydrolysis. The seed members of this model are all in the vicinity of other genes involved in the processes of xanthine/urate/allantoin catabolism. Although not included in the seed, many eukaryotic homologs of this family are included above the trusted cutoff. Below the noise cutoff are related hydantoinases.
Statistics
?
PSSM-Id: 163175
View PSSM: TIGR03178
Aligned: 9 rows
Threshold Bit Score: 592.05
Threshold Setting Gi: 499754558
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3E74_A        24 DLIIKNGTVILENEARVVDIAVKGGKIAAIGQd---LGDAKEVXDASGLVVSPGXVDAHTHISEPG---RSHWEGYETGT 97  Escherichia col...
WP_000006873   4 DLIIKNGTVILENEARVVDIAVKDGKIAAIGQd---LGDAKDVMDASGLVVSPGMVDAHTHISEPG---RSHWEGYETGT 77  Escherichia
WP_003243112   4 DMVIKGAKAVTPDGVIEADIVVQNGVIAEIGSd--iEASGTEIIQADGKYVFPGVIDCHVHFNEPG---REDWEGFETGS 78  Bacillus subtilis
WP_011248568   3 DLCITGGRVVLPSGVEETDVGIQAGKIARIGPi--nKKEARCIMNANGQYVFPGAVDTHVHFSEPG---RTEWEGFFTGS 77  Bacillus clausii
WP_010887796   4 DLLLRGAVLVTPEGERRADLGIVGGQIAELTDe--iATPAAQTLDVSGLHVFPGVLDDHVHLNEPG---RTHWEGFETGT 78  Deinococcus rad...
WP_011395051   3 GVAIRSRRVITDQGMQPATVLMAGGKIVEVQPydmsIDADYKLVDVGNDVVMPGLVDTHVHINEPG---RTEWEGFNTAT 79  Hahella chejuensis
WP_003972680   5 ELVLRSTRVITPEGTRAASVAVTGEKITAVLPydapVPAGARLEDVGDHVVLPGLVDTHVHVNDPG---RTEWEGFWTAT 81  Streptomyces
WP_011435292  13 pqALRSRRVVLPGGERPAAVHVADGRIAAITAad-eIPPGTLVTDLGELALLPGVVDSHVHINEPG---RTEWEGFATAT 88  Frankia sp. CcI3
WP_011197731   4 DSIIKNGLVILENGEQEVEVGIKDGKIAAIGQd---LGTSAKIIDAKGSIVSPGMIDAHVHITEPGggyRDEWEGYDTGT 80  Bacillus lichen...
3E74_A        98 RAAAKGGITTXIEXPLNQLPATVDRASIELKFDAAKGKLTIDAAQLGGLV---SYNIDR-LHELDEVGVVGFXCFVATCG 173 Escherichia col...
WP_000006873  78 RAAAKGGITTMIEMPLNQLPATVDRASIELKFDAAKGKLTIDAAQLGGLV---SYNIDR-LHELDEVGVVGFKCFVATCG 153 Escherichia
WP_003243112  79 QMMAAGGCTTYFDMPLNCIPSTVTAEHLLAKAELGRQKSAVDFALWGGLV---PGHIED-IRPMAEAGAIGFKAFLSKSG 154 Bacillus subtilis
WP_011248568  78 RSLAAGGTTTYVEMPLNALPATTNRANLQRKLEAAKGQNYVDYSFYGGLV---PTNLHE-LADLSASGVVAFKCFLSPCG 153 Bacillus clausii
WP_010887796  79 QALAAGGATSFLDMPLNSSPPVLTRERFEDKARLGEEKSLIDFGLWGGLT---PLNLDQ-LDDLAECGVIGLKAFMSHSG 154 Deinococcus rad...
WP_011395051  80 QAAAAGGITTLVDMPLNCIPVTTTANAFRTKLDAVSDKLWVDCGFWGGVV---PENIDE-LPALLDAGVLGVKSFLIDSG 155 Hahella chejuensis
WP_003972680  82 RAAAAGGITTLVDMPLNSIPPTTTVDNLRTKREVAADKAHIDVGFWGGAL---PDNVKD-LRPLHEAGVFGFKAFLSPSG 157 Streptomyces
WP_011435292  89 RAAAAGGVTTIIDMPLNSVPPTTSLAALAAKRAVAAGQVAVDVGFWGGIIgadARNLDD-LAALHGAGVFGFKAFLAPSG 167 Frankia sp. CcI3
WP_011197731  81 RAAAKGGVTTFIEMPLNQVPATVDEESIQEKFKAGKGKLSVDVASYGGLV---PFDLDGgIQELDSNGVVAYKCFLATCG 157 Bacillus lichen...
3E74_A       174 DrgidN---DFRDVNDWQFFKGAQKLGELGQPVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYL 250 Escherichia col...
WP_000006873 154 DrgidN---DFRDVNDWQFFKGAQKLGELGQPVLVHCENALICDALGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYL 230 Escherichia
WP_003243112 155 T----D---EFRSVDERTLLKGMAEIAAAGKILALHAESDAITSYLQMVLANKGKVDADAYAASRPEEAEVEAVYRTIQY 227 Bacillus subtilis
WP_011248568 154 S----DipgDFRNVDLNGLRAGMRLLAEKGQLLCVHAEDPSMISQL--EAKLLSPVGADAYVASRPVEAEVKAVCDTLAA 227 Bacillus clausii
WP_010887796 155 L----D---EFPAADDLTLYEGMRTAKRHGLVVATHAESNEFTRRLTETARAQGKSGVRDYLESRPVVTELEAVQRALLF 227 Deinococcus rad...
WP_011395051 156 I----D---EFPPVTESDVKRAMPILARYGVPYLIHAELDKEHS-----PPPAIGNSYQSFLASRPKAWENDAIDLMIGA 223 Hahella chejuensis
WP_003972680 158 V----D---EFPHLDQEQLARSLAEIAAFDGLLIVHAEDPHHLAA----APQQGGPKYTHFLASRPRDAEDTAIATLLAQ 226 Streptomyces
WP_011435292 168 V----E---EFPHVSMDVLGAAARRTARMGALTVVHAEAPSVLA----LAPPTVGRAFASWLASRPPAAETEAVAALAAL 236 Frankia sp. CcI3
WP_011197731 158 DrsieG---DFMNVDDYSLYEGMKQIAKTGKILSIHAENAAITDKLGEIASKNGETSLRAYVDSRPVFTEVEPIRKIILF 234 Bacillus lichen...
3E74_A       251 AKVA-----GCRLHVCHVSSPEGVEEVTRARQEGQDITCESCPHYFVLDTDQFEEIGTLAKCSPPIRDLENQKGXWEKLF 325 Escherichia col...
WP_000006873 231 AKVA-----GCRLHVCHVSSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIRDLENQKGMWEKLF 305 Escherichia
WP_003243112 228 AKVT-----GCPVHFVHISTAKAVRLIREAKQEGLDVSVETCPHYVLFSHDDLRQRGSVAKCAPPLRSRQSKETLIETLI 302 Bacillus subtilis
WP_011248568 228 ARET-----GCRIHFVHISSAAAIEAIERAKEEGVDVTVESCPHYFLLSAEELAELGPLAKCQPPLRPKQEQAKLWACLL 302 Bacillus clausii
WP_010887796 228 AQDT-----GAALHLVHVSSGAAVALAYEGKQKGIDVTIETCPHYLHFTGEDVERVGAALKCAPPLRDPAVQEELWRELL 302 Deinococcus rad...
WP_011395051 224 ARDFkaqgvDCKVHIVHLSSAEALAAIGAAKESGLTFTVETCPHYLTLFAEAIPDGKTLFKCCPPIRENDNRERLWQALE 303 Hahella chejuensis
WP_003972680 227 AKRF-----NARVHVLHLSSSDALPLIAEARADGVRVTVETCPHYLTLTAEEVPDGASEFKCCPPIREAANQDLLWQALA 301 Streptomyces
WP_011435292 237 SAAS-----GARLHVLHLAAADALDDVLAARDAGLPMTVETCPHYLTFTAEEVPDGATVFKCAPPIRDSRNLDRLWDGVA 311 Frankia sp. CcI3
WP_011197731 235 AKET-----GCRVHIVHIACEEGVDEIVKAQQEGVDITCETCTHYLYFYKEELDHIGPVVKCSPPIREQSRLEGMWNRVL 309 Bacillus lichen...
3E74_A       326 NGEIDCLVSDHSPCPPEXK---AGNIXKAWGGIAGLQSCXDVXFDEAvQKRGXSLPXFGKLXATNAADIFGL-QQKGRIA 401 Escherichia col...
WP_000006873 306 NGEIDCLVSDHSPCPPEMK---AGNIMKAWGGIAGLQSCMDVMFDEAvQKRGMSLPMFGKLMATNAADIFGL-QQKGRIA 381 Escherichia
WP_003243112 303 AGDIDMVSSDHSPCRPSLKr--EDNMFLSWGGISGGQFTLLGMLELA-LEHQIPFETIAEWTAAAPAKRFGL-QKKGRLE 378 Bacillus subtilis
WP_011248568 303 DGQIDWLASDHSPCTPDLK---DGDFLTAWGGISGCQNNIDIMFDAAvKRRGMPPEQLARLIATNPAKRMNL-REKGEIA 378 Bacillus clausii
WP_010887796 303 AGHIDTVGSDHSPAPPDMKt--SEDFFSLWGGISGAQSTLNVMLEDGyAQRGLPLEIIAALLALNPAQRFGL-PQKGRLA 379 Deinococcus rad...
WP_011395051 304 QRLIDFVVSDHSPCTPQLKeidSGDIEKAWGGISALQFSLPLVWHEA-HQRGLSLPFISRLMSWETARFAGLsHRKGRLA 382 Hahella chejuensis
WP_003972680 302 DGTIDCVVTDHSPSTADLK---TDDFATAWGGIAGLQLSLPAMWTAA-RGRGLGLEDVVRWMSERTAALVGLdARKGAIA 377 Streptomyces
WP_011435292 312 QGLFAGIVTDHSPSTPALKqidAGDFAAAWGGIASVQIGLPAVWTQA-RARGHTLTDVVGWMCAGPADLVGL-AGKGRIA 389 Frankia sp. CcI3
WP_011197731 310 NGDISFVTSDHSPCTPDLKa--TDNAFEAWGGIAGLQNNVDVLFDEGvQKRNMPLSKFAAIIATNPAKRFNL-ASKGSIA 386 Bacillus lichen...
3E74_A       402 PGKDADFVFIQPNSSYVLTNDDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEQgFPVAPKGQFIL 469 Escherichia coli K-12
WP_000006873 382 PGKDADFVFIQPNSSYVLTNDDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEQgFPVAPKGQFIL 449 Escherichia
WP_003243112 379 AGCDADFVLVSM-EPYTVTRESMFAKHKKSIYEGHTFPCSISATYSKGRCVYNDGE-KVTEIDGALVV 444 Bacillus subtilis
WP_011248568 379 IGKDADFAFVDDRQSYTLTKEQLYYKNKHSPYVGRTIGCKVRRVLLRGQTIYTEEKgIIGKPSGELLH 446 Bacillus clausii
WP_010887796 380 VGADADFALVALGEKFTL--DTLYDRWQQNPYRGQSFQGRVHATYLRGQPVYQNGE-FTGTPRGRLLR 444 Deinococcus radiodurans
WP_011395051 383 PGYDADVLVFDDHQAVTISKDMIKHRHKITPYEGMQATGAIRQTWLRGQCIYKDDQ-FIGAAKGQPLL 449 Hahella chejuensis
WP_003972680 378 PGHDADFAVLAPDETFTVDPAALQHRNRVTAYAGKTLYGVVKSTWLRGERIVADGA-F-TDPKGQLLD 443 Streptomyces
WP_011435292 390 IGADADLVIFDADASFLVEPSMLRHRHPLTPYAGRVLNGVVLATYLRGRRADGDRP-----PRGRLLE 452 Frankia sp. CcI3
WP_011197731 387 VGKDADFVFIKKDAPYELKAEDLAYRHKISPYIGRKIGAQVVKTILRGVEIYDKEKgISNEKVGRFIP 454 Bacillus licheniformis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap