Conserved Protein Domain Family
soxL2

?
TIGR03171: soxL2 
Rieske iron-sulfur protein SoxL2
This iron-sulfur protein is found in a contiguous genomic region with subunits of cytochrome b558/566 in several archaeal species, and appears to be part of a cytochrome bc1-analogous system.
Statistics
?
PSSM-Id: 132215
View PSSM: TIGR03171
Aligned: 5 rows
Threshold Bit Score: 560.65
Threshold Setting Gi: 499288435
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAS17977       3 LKIRL-GNGEKGVLKTSDLYFIQKLLRTMRNPKTRFDSREFVEKGEDYLFNYVGKNVGGIDEGRRNFLKGIVIGVAAATV 81  Metallosphaera ...
CAI64225       6 IKFKL-NKDEKPILSPSDFYFINKLLAKMRNPKTKFDSREFVKKGDDYLFNYVDKNLGGIDEGRRRFLKGLVIGIGAAAV 84  Acidianus ambiv...
WP_011278668   2 IKFRLgNDEEMKILDYSDLVFFRKLTNKMRDPKTRFDVREFINRGEDYLFNYTNKNVGGVDERRRKFLKSLIFGMAAAAV 81  Sulfolobus acid...
WP_009991446   2 IRFKS-DKEDKPILEYPDLAFIRKLIRKMRDPKTKFDAKEFVNKGEDYLFNYTNKNVGSVDEKRRKFLKSLIFGIAAAAV 80  Sulfolobus solf...
WP_010979725   2 IKIRLgDKDEKTVLNYSDLVFIKRLLAKMRDPKTKFDSKEFVSKGEDYLFNYVNKNVGSVDEKRRKFLKGLIFGIAAATV 81  Sulfolobus toko...
AAS17977      82 VGIIPGLRVLVPP-VEQATGFPKSLLVDVSGNPLKASSIPVNSPIITLYEYPLTGEPNFLLNLGDKSGNPVSIAPVEVSV 160 Metallosphaera ...
CAI64225      85 VGLIPGLRVLQPPeVAAISGFPKSLLVDSSGSPILASKIPVNSPIITIYEYPLTGEPNFLLNLGDSSGKPVKLSPATVVV 164 Acidianus ambiv...
WP_011278668  82 VGIIPGVSVLVPPtVTVATGFPKSLLIDSSGNPVKASSLPVNSPYIMVFEYPMTGEPNFLINLGDSSGRPVEINPTKVVI 161 Sulfolobus acid...
WP_009991446  81 VGVIPGLKVLVPPtVTVTSGFPKSLLVDSSGSPIKASEIPVNSPFIIIFEYPMTGEPNFLINLGDSTGKPIEIPSTSVVV 160 Sulfolobus solf...
WP_010979725  82 AAIIPGVEVVVPPqVAAVSGFPKSLLVDSSGNPIKASEIPVNSPYIVLFEYPMTGEPNFLLNLGDSSGKPVEVPPTKVVV 161 Sulfolobus toko...
AAS17977     161 PQTGKTYKFPGGVGPNNSIVSYSAICQHLGCTPPYIHFYPPNYVGPSQLTAPEPNTLTAQALLAAKQANIPALIHCDCHG 240 Metallosphaera ...
CAI64225     165 PQTGDKYTWPGGVGPYGSIVSYSAICQHLGCQPPYIHFYPPNHVNPAQESAPEPDTLTPQAVAAAQSNHVPAIFHCDCHG 244 Acidianus ambiv...
WP_011278668 162 PQTGKTYDFPGGVGPNKSIVAYSAICQHLGCTPPYIHFYPPNYVNSGQLTASEPDQLTAAALLAARQANVPALIHCDCHG 241 Sulfolobus acid...
WP_009991446 161 PQTGKTYTFPGGVGPNKSIVAYSAICQHLGCTPPYIHFYPPQYVGPSQLTASEPDQLTAAALLAAKQAKVPALIHCDCHG 240 Sulfolobus solf...
WP_010979725 162 PQTGDTYDFPGGVGPNKSIVAYSAICQHLGCTPPYIHFYPPQYVSPSQLTAPEPDQLTAQALLAAKQAKVPAIIHCDCHG 241 Sulfolobus toko...
AAS17977     241 STYDPYGGGAVLTGPTQRPLPAVILEYDSSTDYLYAIGAIGVATYPEGSDGVPSQDPTKDLDTSqYGSSVGSKTQVQAST 320 Metallosphaera ...
CAI64225     245 STYDPYHGAAVLTGPTVRPLPAAILEWDSSTDYLYAVGSIGVGVYPTGSNGVPSKDPKSDLGSS-FGSSVGTKTVVKETE 323 Acidianus ambiv...
WP_011278668 242 STYDPYHGASVLTGPTVRPLPAVILEWDSSTDYLYAIGSVGVAVYPNGSNGIPSQDPTEDLSSS-FGTSVGEKITVSQTE 320 Sulfolobus acid...
WP_009991446 241 STYDPYHGAAVLTGPTVRPLPAVVLEWDPSTDYLYAIGAVGVATYPNGSNGVPTSNPTDDLSSS-FGSSVSDKTTVQETE 319 Sulfolobus solf...
WP_010979725 242 STYDPYRGAAVLTGPTQRPLPTVVLEWDSSTDYLYAVGSIGVAIYPEGANGVPSSDPKADLDTS-FGSPVGNKTTVQETQ 320 Sulfolobus toko...
AAS17977     321 NPF 323 Metallosphaera sedula
CAI64225     324 NPF 326 Acidianus ambivalens
WP_011278668 321 NPF 323 Sulfolobus acidocaldarius
WP_009991446 320 NPF 322 Sulfolobus solfataricus
WP_010979725 321 NPF 323 Sulfolobus tokodaii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap