Conserved Protein Domain Family
alt_F1F0_F1_eps

?
TIGR03166: alt_F1F0_F1_eps 
alternate F1F0 ATPase, F1 subunit epsilon
A small number of taxonomically diverse prokaryotic species have what appears to be a second ATP synthase, in addition to the normal F1F0 ATPase in bacteria and A1A0 ATPase in archaea. These enzymes use ion gradients to synthesize ATP, and in principle may run in either direction. This model represents the F1 epsilon subunit of this apparent second ATP synthase.
Statistics
?
PSSM-Id: 132210
View PSSM: TIGR03166
Aligned: 8 rows
Threshold Bit Score: 156.357
Threshold Setting Gi: 686867404
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011253680   2 KLRIITPLMVVLDEPDVMSLRAEDESGSFGILQGHADLVSSVLPSVVIWKRRDGTPHYCAVRQGVLtvTEKGHMVEIATR 81  Gluconobacter o...
WP_010932710   2 RLKILLPYRVFAIKERVLNIVAETELGSYGFLPNRLDCIAPLVPGILMYKTHDEGETFVAVDQGIL--VKTGPEVVVSVR 79  Chlorobaculum t...
WP_011022411   7 NLKILLPFQVFAEKKGVSRIVAETREGSFGLLPHRLDCVAALEPGIFIYETEAEGEVYVAVDEGIL--IKAGKDVLVSVR 84  Methanosarcina ...
WP_011357798   2 RLELLLPFGVFSVTEKVTRIVAETNCGSWGFLPGRRDCVASLVPGILEYETLESGVSFVAVDCGIL--VKKGSDVVVSVR 79  Pelodictyon lut...
WP_011380981   2 DLKILLPFSVFMEKARVDRIVVETVDGSLGLLPHRLDCVAALVPGILIFETRSEGEIYVAVDEGIL--VKVSAQVTVSVR 79  Nitrosospira mu...
WP_011120166   2 NLTLNTPNEIVLN-LTVNKVVAEGTHGSFCLLPRHVDFLAALVPGLLSWVDETGKESFAAVGNGIL--VKRANDVYVSAE 78  Rhodopirellula ...
WP_011342778   2 RLRVQTPAERILD-CPVTKVVAEGLNGSFCLRPRHVDLVSAVVPGLFYYETAEGQGHYIALDRGLL--VKRETLVSVSVR 78  Pelobacter carb...
KGC46546       6 RVTIATPARVCVDDLPIVSLRAEDASGAFGIRAGHVDFVTLLRASVVRWRTADGATHYAALDGGVLr-VTRGARIEIACR 84  Burkholderia ps...
WP_011253680  82 EAVCGDDLETLKTLVRQHYAALDDARRNANVASVRLQLDAVRRI 125 Gluconobacter oxydans
WP_010932710  80 HAIGGVDLGQLESAVKQQFLDLDERERSVRSTMAKLESSFIRRY 123 Chlorobaculum tepidum
WP_011022411  85 SAIVGTDLSQLREAVEREFLTLDESEKKIRSVMTKLEIGLMRRL 128 Methanosarcina acetivorans
WP_011357798  80 QAVGGVELGALEKAVKEDFLELDEHERTMHSALARLESSFIRRY 123 Pelodictyon luteolum
WP_011380981  80 NAVEGTNLAVLHETVDREFLNLDERAKSIRRTMAKMESGLIRRF 123 Nitrosospira multiformis
WP_011120166  79 AASHGTELEELRRLVREEFSQMDEQQRAAHTAVARLEADFLRRT 122 Rhodopirellula baltica
WP_011342778  79 NAVAAGELEDLLEVVQLRFKALDEQERVVRSAVARLESDFLRRF 122 Pelobacter carbinolicus
KGC46546      85 DAVLGESLAELEAVVRGVRATQLDEKRRARVDETRLHAQAVRRL 128 Burkholderia pseudomallei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap