Conserved Protein Domain Family
UHCUDC

?
TIGR03164: UHCUDC 
OHCU decarboxylase
Previously thought to only proceed spontaneously, the decarboxylation of 2-oxo-4-hydroxy-4-carboxy--5-ureidoimidazoline (OHCU) has been recently been shown to be catalyzed by this enzyme in Mus musculus. Homologs of this enzyme are found adjacent to and fused with uricase in a number of prokaryotes and are represented by this model.
Statistics
?
PSSM-Id: 132208
View PSSM: TIGR03164
Aligned: 10 rows
Threshold Bit Score: 233.793
Threshold Setting Gi: 499567789
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004665858  12 LGRDAFIAAFADIYEHSPWVAQQAFDegaGP--ELDQVETLHARMSKLLLGAPHAQQLALINAHPDLAGKAAIQGELTQA 89  Pseudomonas sav...
WP_011218938  12 MNRSDFVAHFADVYEHSPWVAESVFDavlTE--QDDDIESLHQRMTAILLAASKDKQLALINAHPDLAGRAAVNGELTEA 89  Photobacterium ...
WP_011046621 309 MPKADFVAAYGGIFEHSPWIAERAHGlelGP--AHDTAGGLHNALCRMFRSASAEERLGVLTAHPDLAGKLAQAKRLTAE 386 Ruegeria pomeroyi
WP_027809649  14 MAPSAFVAALSGIFEHSPWVAEVAAG---QR--PFASIDALHQTMSNAVETGGEARQLALINAHPELAGKAAVRGELTAE 88  Burkholderia ce...
WP_011088904  13 ADKADFVAALANVVEYSPWIAEKLAG---QR--PFTGINQLHAALMAAIQSAEPDVQLALIRAHPDLANKTQRAAGLTAE 87  Bradyrhizobium ...
WP_014906496  12 MDTQTLTDTLGSIFEHSSWIAERSAA---LR--PFSSLSDLHRKMTGIVKAADRETQLDLIKKHPRLGTKK----TMSDD 82  Bacillus subtilis
WP_010896931  18 LEKEDFVTKIGPIFEHSPWVAERAWA---HR--PFTSAENMYECMLEKVYEADKRLQLALLRAHPDLGTRL----EISET 88  Bacillus halodu...
WP_010976000   2 SERDDFIRRFGGIFEHSPWVAERAYD---RAasSGLTAGNVHSALCNAFRAASPAERLRVLRAHPDLAGKLAVAGELTAD 78  Sinorhizobium m...
WP_012253323 306 MSAAQFLTRFGDIFEDTPEIALRAWQaglTA--REDSAEGLHAALVGALRGLPAEQQRALIRAHPELAGRLAQAGQLTQA 383 Methylobacteriu...
WP_011248572  10 ADCARFTSMLGHLFEHSPWIPKEAWA---RR--PFASICDLHREMVMVVEEATYEDQLSLIQAHPRLAANE----KVGAS 80  Bacillus clausii
WP_004665858  90 STDEQAGAGIHHCTPEEFQRFTELNEAYKARFGFPFIMAVKGSDRHKILAAFEQRIHHSPEAEFACALAEINKIALFRLQ 169 Pseudomonas sav...
WP_011218938  90 STSEQAGAGIDKCSAEEFERFTHFNNSYKSRFNFPFIMAVKGANRYQILESFEARLDNDSETEFAKAIEEINKIALFRLR 169 Photobacterium ...
WP_011046621 387 STSEQASAGLDALTDEERTTFTRLNTEYVARFGFPFIIAVRDHDKASILAAFQRRIGNDRETEFAEACRQVERIAEFRLR 466 Ruegeria pomeroyi
WP_027809649  89 STREQSGAGLDQCTQEEFDKLLTLNRTYREKFGFPFILAVRGYDRHGIIANFESRVNHSRAEELRASLDQIYRIARFRLD 168 Burkholderia ce...
WP_011088904  88 STDEQNSAGLDRLSDAEYAAFERVNNAYREKFGFPYIVCVRRHTKDSVLRDFETRLLNIAKTETRRAIEEIGRISALRLD 167 Bradyrhizobium ...
WP_014906496  83 SVREQQNAGLGKLEQQEYEEFLMLNEHYYDRFGFPFILAVKGKTKQDIHQALLARLESERETEFQQALIEIYRIARFRLA 162 Bacillus subtilis
WP_010896931  89 SQSEQQRAGLSQLTEEEFAVFAELNKCYVDTFRFPFIMAVRGQTKNSIKEQMRKRLVNDEEQERKTALREVAKIAKFRLA 168 Bacillus halodu...
WP_010976000  79 SKAEQASAGLDRLSPEEHSRFTGLNTTYTKKFGFPFIIAVKGLTKEDILAAFERRIDNSKEEEFETACAEVERIARLRLR 158 Sinorhizobium m...
WP_012253323 384 STTEQGSAGLGALSAEELARFERLNAAYRARFDLPFIMAIKGSSREAILAAFEARLRNDPEQEFQEALRQIERIAWLRLK 463 Methylobacteriu...
WP_011248572  81 SAAEQQDAGLDVLSKREALAFSRLNDVYDKRFGFPFVEAVKGKTAQQLYDSLAERINSTKEAEFNRALAEIFQIAWYRLE 160 Bacillus clausii
WP_004665858 170 AL 171 Pseudomonas savastanoi
WP_011218938 170 DM 171 Photobacterium profundum
WP_011046621 467 DV 468 Ruegeria pomeroyi
WP_027809649 169 DL 170 Burkholderia cenocepacia
WP_011088904 168 QL 169 Bradyrhizobium diazoefficiens
WP_014906496 163 DI 164 Bacillus subtilis
WP_010896931 169 DL 170 Bacillus halodurans
WP_010976000 159 SM 160 Sinorhizobium meliloti
WP_012253323 464 DR 465 Methylobacterium extorquens
WP_011248572 161 AF 162 Bacillus clausii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap