Conserved Protein Domain Family
sulfolob_CbsA

?
TIGR03154: sulfolob_CbsA 
cytochrome b558/566, subunit A
Members of this protein family are CbsA, one subunit of a highly glycosylated, heterodimeric, mono-heme cytochrome b558/566, found in Sulfolobus acidocaldarius and several other members of the Sulfolobales, a branch of the Crenarchaeota.
Statistics
?
PSSM-Id: 132198
View PSSM: TIGR03154
Aligned: 3 rows
Threshold Bit Score: 822.729
Threshold Setting Gi: 499226438
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010923978  10 SIKRKSKYTLGVLLLASFLAIIMGLANVPMAQTSPQIPVYKVVGNADLSNPGSASYWSQIPWINISLTANIPMAPTSGLT 89  Sulfolobus solf...
WP_011278666   2 SLKIKSKITIGVLLIIFLLSIIFTLENVSLAQTSPQISVYKVVGSADLSNPGSAGYWSQIPWTNISLTANIPMAPTSGLT 81  Sulfolobus acid...
WP_010979723   2 SVKPSTKLTISIVLSVLLLGVLLAVTNTPMAQTSPDIPVYKVVGTADLSNPGSASYWSNIPWINISLTANIPMAPTSGLT 81  Sulfolobus toko...
WP_010923978  90 HYLLVKAVWNGSWIIILERWYAPEPAFGAWSAAAAALYPPASGPGLFRQIMLTPGTTYTIEKNYTNYFSIVNGNIIQGRL 169 Sulfolobus solf...
WP_011278666  82 HYLLVKAAWNGSWIFILEEWQAPEPAFNAWSTAVAGIYPNASGPGLFRMIELTPGTTYSLERNYTNYVSIINGKEETGRI 161 Sulfolobus acid...
WP_010979723  82 HYVLVKAAWNGSWIFVLVKWYAPNPAFGAWSAAAAGIYPPAAGPGLFRQIMLTPGTTYTIEKNYTNYISIVNGKTYQGRL 161 Sulfolobus toko...
WP_010923978 170 VLNYSGILLPAPNDTQITVLSNGTIILWHSPRPIEDLLYSDGMFYGYYTNNTWYYPDRAAIMWYMGSVIPpTKDGMNIGG 249 Sulfolobus solf...
WP_011278666 162 VFNYSGITLPAPNNTEITVMSNGTILLWHSPRPVEDLLYNDGMFYGYYVNSTWYYPDRAAIMWYLGSGVP-TKDDMNIGG 240 Sulfolobus acid...
WP_010979723 162 VLNYSGILLPTPNGTQITVLSNGSIILWHSLRPMEDLLYSDGMFYGYYTNSTWYYPDRVAMMWYMGSVIPpSKDGMNIGG 241 Sulfolobus toko...
WP_010923978 250 KVPGQAFDGVTFNDTGGSLVQPGGAANIWMWVSGATWNNATYDPAFKVNLWQNTSLTGLPYIDPDNHGFAVPLYTNNTNM 329 Sulfolobus solf...
WP_011278666 241 KYPGQQFDGITFKDAGGSLAQSGGSANIWMWVSGATWNNSTYDPAFKSNIWQNESLTGLSYVDSGNHGFAVPLYTNNTNM 320 Sulfolobus acid...
WP_010979723 242 KYPGQKFDGVTFKYAGGSLAQPGGAANIWMWVSGATWNNSTYDPAFKVNLWQNESLTGLPYVDPGNHGFAVPLYTNNTDM 321 Sulfolobus toko...
WP_010923978 330 YEVDTAGIWYTPVTTSGLNGSLFFIWTGATYQNGYWTVEFARPLAVPSAYAKWMPNITVGKTYYVAFAVWQGKLGETLFD 409 Sulfolobus solf...
WP_011278666 321 YEVDTAGIWYTPVASEGLNGSLFFIWTGAKYENGSWVVEFARPLSVPLDYQPFMPNITVGKTYYVAFAVWQGRLGETLFD 400 Sulfolobus acid...
WP_010979723 322 YEVDCAGIWYTPVASKGLNGSLFFIWTGATWSNGYWTVEFARPLAVPPNYANWMPNITVGKTYYVAFAVWQGKLGETLFD 401 Sulfolobus toko...
WP_010923978 410 KSITSNFLTLELvttppTStttSTISSTSVTTTTSITTVTSIPSTTIYVTIVGVVIAIIALIILYVVFRR 479 Sulfolobus solfataricus
WP_011278666 401 KSITSSFLSLEL-----VT---TPPTSTTTSTSPVTTISSAIPPVTLYVTIIGVVVALVALVILYVVFRR 462 Sulfolobus acidocaldarius
WP_010979723 402 KSITSSFLTLQL-----VTtppTSTTTTTTSVSSSTSTSAAIPSTTVDVTVAGAVIAILALVILYVVYRR 466 Sulfolobus tokodaii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap