3BO9


Conserved Protein Domain Family
enACPred_II

?
TIGR03151: enACPred_II 
Click on image for an interactive view with Cn3D
putative enoyl-[acyl-carrier-protein] reductase II
This oxidoreductase of the 2-nitropropane dioxygenase family (pfam03060) is commonly found in apparent operons with genes involved in fatty acid biosynthesis. Furthermore, this genomic context generally includes the fabG 3-oxoacyl-[ACP] reductase and lacks the fabI enoyl-[ACP] reductase.
Statistics
?
PSSM-Id: 132195
View PSSM: TIGR03151
Aligned: 8 rows
Threshold Bit Score: 448.044
Threshold Setting Gi: 163931227
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3BO9_A        16 RTRVTDLLEIEHPILXGGXAWAGTPTLAAAVSEAGGLGIIGSGAXKPDDLRKAISELRQKTDKPFGVNIILVSPWADDLV 95  Thermotoga mari...
WP_011098452  10 ENAFCNMIGLDYPIIQGAMAWIANSSLASAVSNAGGLGIIASGNQPVDIVKEEIRKTKELTNKPFGVNIMLLSDNAEELA 89  Clostridium tetani
WP_011460502   3 KTKLCDLIGIEYPVFQGGMAWTATGELAAAVSEAGGLGIIGAGQAPADWLRQEIHKIKKVTNKPYGVNVMLMSPFVEDVM 82  Desulfitobacter...
WP_011344356   2 KTKITELLKIKYPIIQGGMAWVATARLAAAVSNAGGLGIIGAGNAPAEWVLAEVRKVKNLTDKPFGVNVMLLSPHVDEVM 81  Carboxydothermu...
WP_000857467   2 KTRITELLNIKYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGNAPKEVVKANIDKIKSMTDKPFGVNIMLLSPFVDDIV 81  Streptococcus a...
WP_024103713   2 RTRVTDLLEIEHPILMGGMAWAGTPTLAAAVSEAGGLGIIGSGAMKPDDLRKAISELRQKTDKPFGVNIILVSPWADDLV 81  Thermotoga mari...
WP_011392462   3 RTPLCDLLGITYPIIQGGMAWVATGELAAAVSAAGGLGIIGAGSAPPDVVRREIRKVREQTDRPFGVNIYYLSPYVEELV 82  Moorella thermo...
EEI57568      16 NQELCELLGINYPIFQGGMAWVADASLASAVSNAGGLGIIAGGNAPKEVVKKEIKKVKELTEQPFGVNIMLLSPFADEIV 95  Enterococcus fa...
3BO9_A        96 KVCIEEKVPVVTFGAGNPTKYIRELKENGTKVIPVVASDSLARXVERAGADAVIAEGXESGGHIGEVTTFVLVNKVSRSV 175 Thermotoga mari...
WP_011098452  90 KLICEENIKVVTTGAGNPGKYIDMWKKSGVKVIPVVASVALAKRMERAGADALIVEGCEAGGHIGELTTMALLPQVVDAV 169 Clostridium tetani
WP_011460502  83 QVIVEERVPVITTGAGNPGKYIPMLKEVGTKIIPVVASVALARRLEKAGVDALIAEGMESGGHIGEISTLPLVPQVVDAV 162 Desulfitobacter...
WP_011344356  82 EVIIEEKVPVITTGAGNPGKYIKKLKENNVKIIPVVASVALAKRLEKTGVDAVIAEGHESGGHIGELTTMALVPQVVDNV 161 Carboxydothermu...
WP_000857467  82 DLVIEEGVKVVTTGAGNPGKYMERFHEAGITVIPVVPSVALAKRMEKLGADAIITEGMEAGGHIGKLTTMTLVRQVVDAV 161 Streptococcus a...
WP_024103713  82 KVCIEEKVPVVTFGAGNPTKYIRELKENGTKVIPVVASDSLARMVERAGADAVIAEGMESGGHIGEVTTFVLVNKVSRSV 161 Thermotoga mari...
WP_011392462  83 DLVCEERVPVVTTGAGNPGKHLPRFKEAGVKVIPVVASVALAKRLERLGVDALVAEGMECGGHIGEIATMPLVPQIVDAV 162 Moorella thermo...
EEI57568      96 DLVCEEQVPVVTTGAGNPAKYMARFKEHNIKVIPVVPSVALAKRMEKIGADAVIFEGMEAGGHIGKLTTMSGLPQIVDAV 175 Enterococcus fa...
3BO9_A       176 NIPVIAAGGIADGRGXAAAFALGAEAVQXGTRFVASVESDVHPVYKEKIVKASIRDTVVTGAKLGHPARVLRTPFARKIQ 255 Thermotoga mari...
WP_011098452 170 NIPVIAAGGIGDKRGVLATFALGAIAVQVGTRFLVAKECNIHRNYKEKVLKAKDIDTVVTGRNTGHPVRVLRNRLTRKYQ 249 Clostridium tetani
WP_011460502 163 SIPVIAAGGIYDGRGMVAALALGAEGVQMGTRFMCAEECTISSKVKEMILKAKDRDTVVTGRSTGHPVRCLGNKLTREFE 242 Desulfitobacter...
WP_011344356 162 SIPVVAAGGIADGRGLVAALALGAQAVQIGTRFLCAEETEIHPAVKEAVIKAGDRDTVITGASTGHPVRVIKNKLARRFL 241 Carboxydothermu...
WP_000857467 162 TIPVIAAGGIADGRGAAAGFMLGADAVQVGTRFVVAKESNAHPNYKAKILKAKDIDTAVSAQVVGHPVRALKNKLVTTYS 241 Streptococcus a...
WP_024103713 162 NIPVIAAGGIADGRGMAAAFALGAEAVQMGTRFVASVESDVHPVYKEKIVKASIRDTVVTGAKLGHPARVLRTPFARKIQ 241 Thermotoga mari...
WP_011392462 163 HIPVIAAGGIADGRGLAAALALGAAGIQMGTRFICATECTVHANYKEAVLKAGDRDAVVTG-MAGHYVRVLKNKLTRQFE 241 Moorella thermo...
EEI57568     176 SIPVIAAGGIGDGRGMAAAFMLGAEAVQLGTRFLIAKECNVHPDYKQKVLKARDLDAVITCQHFGHPVRTLKNKLTAQYN 255 Enterococcus fa...
3BO9_A       256 EXE-----F----E--NPXQAEEXLVGSLRRAVVEGDLERGSFXVGQSAGLIDEIKPVKQIIEDILkEFKETVEKL 320 Thermotoga maritima...
WP_011098452 250 ILE-----K----EnaPMEEFEKITKGALIKAVKEGDIQTGSLMAGQIAGLISKEQSCKEIIKEMF-DFKEVIKRL 315 Clostridium tetani
WP_011460502 243 QLE-----K----EgtDPEVLEKMGAGKLRLAMVEGDTQNGSVMSGQIAGAVQKIEPAATIIQDVMqGSERELARL 309 Desulfitobacterium ...
WP_011344356 242 ELE-----Q----KgaPPEELEKLGAGSLRRCMQEGDIEEGSLMAGQIAGLIKEIKPVKEIIEEIMhEAREIMKRI 308 Carboxydothermus hy...
WP_000857467 242 QAE-----KdylaGriSINEIEELGAGALRNAVVDGDVINGSVMAGQIAGLIKSEETCQEILEDIYsGARQVILSE 312 Streptococcus agala...
WP_024103713 242 EME-----F----E--NPMQAEEMLVGSLRRAVVEGDLERGSFMVGQSAGLIDEIKPVKQIIEDILkEFKETVEKL 306 Thermotoga maritima
WP_011392462 242 ELS-----A----RgaSWEEMDRLGTGKLRAAAVDGDVEYGSVMAGQSAAMVREIKPAAAIIAEIMaEAAEVIARL 308 Moorella thermoacetica
EEI57568     256 QLEkqelqK----EvpDLEMFEKIGQGALRKAVVDGDMDYGSVMAGQIAGLIKKEETAQEIIDSLMsECKAIVHKM 327 Enterococcus faecal...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap