Conserved Protein Domain Family
AhpF_homolog

?
TIGR03143: AhpF_homolog 
putative alkyl hydroperoxide reductase F subunit
This family of thioredoxin reductase homologs is found adjacent to alkylhydroperoxide reductase C subunit predominantly in cases where there is only one C subunit in the genome and that genome is lacking the F subunit partner (also a thioredcxin reductase homolog) that is usually found (TIGR03140).
Statistics
?
PSSM-Id: 132187
View PSSM: TIGR03143
Aligned: 5 rows
Threshold Bit Score: 862.933
Threshold Setting Gi: 494116792
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_007056574   4 TNNLYDVVVIGGGPAGLTAGLYLARARYRVLILEKDDFGGQITITNEVVNYPGVGRTTGRALTQTMRQQAQDFGAEFLSA 83  Bifidobacterium...
WP_010706831   2 TEEIYDLIIIGGGSAALSAGIYAGRAMMDTLIIEKDKIGGQVTTTSEIVNYPAIRHTTGPELMEEMRIQAQDFGVAFTND 81  Enterococcus fa...
WP_011459124  22 MKELYDLIIIGSGSAGMAAGIYAGRSKLKTLVIDRDRAGGQIKITSEVENYPGILNISGEELSQAMRRQAEKFGVKFRQA 101 Desulfitobacter...
WP_011010029   1 MSKIYDLVIIGGGPAGLSAGIYAGRAKMNTLIIEKGELGGQVNKTFDISNYPGSRNTNGPKLMSEMRAQAEDFKVKFMNG 80  Clostridium per...
WP_011015958   1 MERIYDMIVIGGGPAGLSAGIYGGRAKLDVLIIEKENKGGQISLTSEVVNYPGILEISGSEFMTQTKKQAQGFGVNFVQE 80  Fusobacterium n...
WP_007056574  84 EATGLDVDGDIKTVHTSRGDLKTFGILIATGASPRKLGFEGEAEYAGRGVAYCATCDGEFFTGKEVLVVGGGFAAAEESV 163 Bifidobacterium...
WP_010706831  82 EIIDVDFSQTIKTVQSASQTYQAYAVLIATGASARKIGFPGESEFTGRGVAYCSTCDGEFFQGLDIFVIGGGYAAAEEAV 161 Enterococcus fa...
WP_011459124 102 AVESVDLAGDIKKIRTAEGDYEALAVIIATGSVPRKLGFIGEEEFRGRGIGYCATCDGEFFTGMDVFVIGGGLAAAEEGI 181 Desulfitobacter...
WP_011010029  81 EVLEVSLEGDIKEIKTDKGLVQGRSVIIATGAAPRQLGFKGEEEFTGRGVAYCATCDGQFFEGLEVFVIGAGFAAAEEAI 160 Clostridium per...
WP_011015958  81 EVLDMDFTEKIKTIKTNNAEYKTLSVVIATGAAPRKLGFPGEQEFTGRGVAYCATCDGEFFTGMDIFVIGAGFAAAEEAM 160 Fusobacterium n...
WP_007056574 164 FLTKYASKVTVLVREPDFTCDAAVAAEAKNNPKIDVRYQVELKGVTaGQGGLREASILNLATGQTETWK-PADAgTFGVF 242 Bifidobacterium...
WP_010706831 162 YLTRYGKSVTMIIREPDFTCAKLTAEAAKNHPKIKIVYNIEVKEIT-GDDFVRKAVFVNNQTGEETVYEaPKDS-TFGLF 239 Enterococcus fa...
WP_011459124 182 FLTRYARKVTMIVRGDGFSCPQTISERVLAHPKIEVKFNTELREAG-GDAVLRYAEFVNNRSGERWRYDvREQKqTFGVF 260 Desulfitobacter...
WP_011010029 161 FLTRFASKVTVIAREPEFTCAKSIADKVLSNPKIEVKFNTEIIEAK-GKDMVNYAKFKNNVTGEIFEYRaKKEDgAFGIF 239 Clostridium per...
WP_011015958 161 FLTKYGKSVTIIAREPDFTCAKLIGDKVKAHPKITVKFNTELTELT-GDVKPTAAKFKNNVTGEITEYKaKVGE-TFGVF 238 Fusobacterium n...
WP_007056574 243 VFAGYVPATDLVRGVVELDdHGYVVTHDYLRTSVPGVYAAGDLRVKNLRQVVTATADGAIAAVELERYAKQMSEKTGlvp 322 Bifidobacterium...
WP_010706831 240 VFAGNKPSTEIFEGKIALD-RGYVPTTENMETNIPGVYAAGDLRIKELRQIVTAVADGAIAATHAQRYVTEQKTQAGqsi 318 Enterococcus fa...
WP_011459124 261 VFVGYIPQSAEYAQEVRIDeRGYIPTDESMGTNVEGVYAAGDIRPKELRQLVTAVADGTIAATSAEKYLVGKKERLG--- 337 Desulfitobacter...
WP_011010029 240 VFVGYAPKSELFKDILELDkQGYIITNEDMETNINGVYVAGDLRPKSLRQIVTAVSDGAIAATTAERYVKELKEKLG--- 316 Clostridium per...
WP_011015958 239 VFVGYAPSSQIFKGHIEIDkAGFIPTNEDLMTNVDGVFAVGDIRPKRLRQVVTAVADGAIAATSIEKYVHDLREELG--- 315 Fusobacterium n...
WP_007056574 323 -prpTASAYEESEAKAASAASAAGTTPApapakrsadaaaaasAAKKPGELFSAAVKQQLGVVFGRMTRPVTLALELDGT 401 Bifidobacterium...
WP_010706831 319 vtkrMTERLANQSAPETSSQQPKEKQPA---------------KVTGKHQWFPESMRQQLSGIFAKLTKKVTLLQFLDAS 383 Enterococcus fa...
WP_011459124 338 ----LGELGELGESGERDELSDEEKTPV----------------TRQGTSLLDDSLKEQLVPILERLENRIGLLAFLEGS 397 Desulfitobacter...
WP_011010029 317 ----IEDEYLEEEENIQEEKNSDENNDLg--------------NISRKSSLLNDVLRAQLKGILSKIENEVTLVSIVDRS 378 Clostridium per...
WP_011015958 316 ----IKKEEKKEEK----------TTSV----------------TTEKEHFLDNELRQQLVAVVDRFENPVEIVVFKDPN 365 Fusobacterium n...
WP_007056574 402 P-LSAELQGFIGEMVALSgGKLNSVAVDAAglitavdgasvptslvvGEPLSVTLPDGTELPTYGSLDDSGratfdvagv 480 Bifidobacterium...
WP_010706831 384 DeKSLELQSFLTEFASLD-QKITLETILKD-----------------TEPAKELLYGIEKMPSVVLLDAAG--------- 436 Enterococcus fa...
WP_011459124 398 SgFSEELRSFLSEFAGLT-DKVEVEFLNRG-----------------EDAVREKEAKITLFPAVAVLGPDG--------- 450 Desulfitobacter...
WP_011010029 379 NtKSIELRDLVLDISDLG-EKINAKIFNRG-----------------ENKEVEEKINADKYPIVALLDENE--------- 431 Clostridium per...
WP_011015958 366 NeESVNIENAVKDIASISpEKLKFSSYNEG-----------------ENKELETKVKVTRTPTIAILDKDG--------- 419 Fusobacterium n...
WP_007056574 481 lplarptvricvpaegdgkagkdgngslVFTGLAFHGVPSGHEFNSFVLGLYNAAGPGQPLGDDLVERAKSITDPlNIMI 560 Bifidobacterium...
WP_010706831 437 ----------------------------NYTGIKFSGIPSGHEVNSLVLAVYNVGSEGQPLEASLQKNILALPKR-KIEI 487 Enterococcus fa...
WP_011459124 451 ----------------------------VYTGVQFHGIPGGHEINSFILALYNAAGPGQAVGEETLAKIRRVSRKvNFKI 502 Desulfitobacter...
WP_011010029 432 ----------------------------NYSGIKFHGVPGGHELNSFILAIYNLGGPGQGIDEGVLDEIKKLDKKtNIKV 483 Clostridium per...
WP_011015958 420 ----------------------------NYTGLKYSSLPSGHELNSFILGLYNVAGPGQKVATESLEKIEKINKPvNIKI 471 Fusobacterium n...
WP_007056574 561 LVSLTCTMCPETVLASQRIASLSPAVRAEAYDVSHFPELKDQYGAMSVPCIVITHadgtQQVEFGKKSIPQMLELVG 637 Bifidobacterium lo...
WP_010706831 488 FVSLTCHFCPDVVAACQRIASINPHVEAEMVDISLFPELKKEKKIMSVPAMLIDG----EQMIFGSKTMTEIIEALA 560 Enterococcus faecalis
WP_011459124 503 GVSLSCTLCPDVVTLAQLMALKNPLIEAEMIDVAHYPDFKNKYGIMSVPAIVVND----EKVVFGKKNLEELLELAG 575 Desulfitobacterium...
WP_011010029 484 CVSLSCHLCPDVVVSAQRIAKENKNIEAEMIDLANFKDIKDEFKIMSVPALIVNN----KDVYFGSKKIEEILEIIK 556 Clostridium perfri...
WP_011015958 472 GISLSCTKCPKTVQATQRIATLNKNVEMEMINIFTFQDFKNRYDIMSVPAIIVDD----QHIYFGEKTVEDMLEIIN 544 Fusobacterium nucl...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap