Conserved Protein Domain Family
malonate_mdcH

?
TIGR03131: malonate_mdcH 
malonate decarboxylase, epsilon subunit
Members of this protein family are the epsilon subunit of malonate decarboxylase. This subunit has malonyl-CoA/dephospho-CoA acyltransferase activity. Malonate decarboxylase may be a soluble enzyme, or linked to membrane subunits and active as a sodium pump. The epsilon subunit is closely related to the malonyl CoA-acyl carrier protein (ACP) transacylase family described by TIGR00128, but acts on an ACP subunit of malonate decarboxylase that has an unusual coenzyme A derivative as its prothetic group.
Statistics
?
PSSM-Id: 132175
View PSSM: TIGR03131
Aligned: 12 rows
Threshold Bit Score: 241.833
Threshold Setting Gi: 490682210
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_003112670   3 VLFAYPGQGAQRPGMLAAL---PDEPPVRACLEQAADCLGQAPAE-L---ESAEALRGTRAVQLCLLIAGVAASRLLETR 75  Pseudomonas
WP_011280413   3 LIILFSGQGLQSQRHIDEVlkvTNENDQSLLHTVIPELFANDSDN-I---FDNETLFDNRFAQPFIYTLQYYRWQQLRQL 78  Psychrobacter a...
WP_004926789   3 SIWVYPGQGAQKINMLHDL---PKHPLVDRYLEQASDVLNENIML-L---DQADSLKSTYSVQLCLYVAGVISSELLRLH 75  Acinetobacter
WP_015961608   3 ILFLFAGQGYHADSLFDIF---RTDKKTINYLKTMSSAAEIDF---L---QNNLEMTNPYSIQSIIGAYQLTLFSRLLPL 73  Legionella pneu...
WP_011063988   3 SLLVFPGQGAQQPGMLQRL---PQSPQTRACLQEASDVLGQDVLT-L---DSPQALASTRAVQLCLLIAGVAAARTLLQP 75  Pseudomonas pro...
WP_011474987   3 IAFLFPGQGSQRAGMLHEL---PAHPSVALTIDEASQVLGRNVLE-L---DEEKILESTVSTQVAIYVAGVAVARALAAE 75  Rhodopseudomona...
WP_011301045   3 VLLTFPGQGSQRAGMLADL---PDHRAVAAVLAEAAEVLQTQPAD-M---DTASRLQSTVWVQLCLLTAGVAMARCLAAE 75  Cupriavidus pin...
WP_011464143   3 YALVFSGQASQHPTMLPWL---DTDPMAADALHAMGLCLGANWRTaI---QDEGCRSNNAFAQVLITGTSLAAWAAVKDK 76  Albidiferax fer...
WP_011289735   3 LALLFSGQGGQTAAHWQQV---QAGATGEWREVLRQVLPGIADQDaM---VAPGILAKNKIAQPLIFAQQMLLWGSLQSR 76  Dechloromonas a...
WP_011050392   3 LALLCPGQGGQHAEMFARV---ADAPAAAAVFASAQRVLGVAPQA-L---AADPGRYANAIAQPLVCAGTLAHWQALCAQ 75  Xanthomonas
WP_003898052   4 PAFLYPGQGSQRAGMIAAL---PPTSATRRVLDEASDALG-GLGY-L---DTADGLASTRNAQLALLICGVAATRTLDEV 75  Mycobacterium s...
WP_004546965   3 IAILCSGQGGQHAGMFALT---ADLPEAAPLFAHAAALLGADPRE-WvrdADDEALRENFAAQLVCTLQAVAAMTRLDVL 78  Burkholderia ps...
WP_003112670  76 GH-R-PGLVAGLSIGAYPAAVVAGALDFDDALRLVALRGELMQAAW-PE----GYGMSAILG-LEQAQLEALILAV---- 143 Pseudomonas
WP_011280413  79 LE-K-PSAFAGYSLGEINAFCCSSQLDFEVGLTLINHRAKFMEEGV-SE----SSGLLAIQG-LHNSELENLLLKT---- 146 Psychrobacter a...
WP_004926789  76 GV-K-PKFVAGLSIGAWAAATVAHVIRFEDGLKLVAKRAQLMQQAY-PK----GYGMTAILG-ADCSQIEQWIEQTqqnq 147 Acinetobacter
WP_015961608  74 FTnH-QVDLAGYSLGEISAFLGSINANPRDSFKLFRYRTQLMTSIV-DNnifaEYDLLSVVGkFILEEIQPVIAKH---- 147 Legionella pneu...
WP_011063988  76 DT-R-VNYVAGLSIGAYPAAVVAGALEFADALRLVSLRGELMQQAY-PQ----GYGMTALIG-LELAAVEGLLAQV---- 143 Pseudomonas pro...
WP_011474987  76 GA-L-PSAVAGLSVGAYAAATACGALAFPDGLRLVHLRASLMEQQF-TT----GYGLAAIVG-LDEEQVTALVAKA---- 143 Rhodopseudomona...
WP_011301045  76 GG-H-ADAVAGLSIGAYAAAVSAEVLPFSDALRIVRLRGELMEQAY-PN----GYGMTAILG-LERMRLEPLVAQI---- 143 Cupriavidus pin...
WP_011464143  77 LP-QaPAVVAGYSVGELSAFACAGVFSTDQAIALAAQRAALMDQAV-SGl---HTGLLAVSG-ISEGRVLAVSAGL---- 146 Albidiferax fer...
WP_011289735  77 LP-R-PICAAGYSLGEMAACSAASAFTAIEGIALCVERAAAMDGAA-AG----EHGMLAVLG-LDDALVATMAAEA---- 144 Dechloromonas a...
WP_011050392  76 LP-T-PLLVLGYSVGELAAHAVAGSMSIDTCLQLAATRARLMDAAS-PQ----QAGLMAVIG-VPLRALETLCQTH---- 143 Xanthomonas
WP_003898052  76 YGvR-PGVTAGHSAGAFAAAVAAGVLTFHEALDAVGVRAAAMEAACaPG----EWGMAAVTG-MGQRAAGALVAEA---- 145 Mycobacterium s...
WP_004546965  79 LP-R-RRCVAGYSVGELAAWSVAGLVEARDALDLVAARARAMDAAS-DG----DARMLFVRG-LARDAVDASCAAH---- 146 Burkholderia ps...
WP_003112670 144 RrehppLYLANVNAERQLVVAGSEAALAALAERARAAGASAAKRLAVSVPSHCALLDEPAARLAEAFAG-IRLHR---PR 219 Pseudomonas
WP_011280413 147 D-----THLSIKINEDQFIIGGHRDNLSQADTLAQSLGARNTQLLKVTVPSHTKMMQKAAEKFCEYIDS-ITLPA---MQ 217 Psychrobacter a...
WP_004926789 148 Q-----VFIANLNTENQVVISGSEQAMQYVIHHAQQNGA-IAKKVEISVPSHCVLLEKQAHQLAGFMEE-IPTQQ---PT 217 Acinetobacter
WP_015961608 148 N-----CYIAIINSAQHVVIGGKISDLRHLITELSQYPISHAKFLGVYLPSHTDFYSDKSKQFQRFLDEnYGFYS---LK 219 Legionella pneu...
WP_011063988 144 HssqrpVYLANINADNQVVIAGSDAAMHAVAELARGCGVGVAKRLAVSVPSHCPLLEQPAQALAAAFAE-VPLQL---PK 219 Pseudomonas pro...
WP_011474987 144 TteqfpVYVGNLNAPRQIVVAGALPGVDRVVELAIATGCKKAERLAVRVPSHCPLLQGVADVLLDKLKT-LEPGT---VR 219 Rhodopseudomona...
WP_011301045 144 HtpqtpVYLANFNAPAQIVIAGSVPAMEAVAALAIASGAQAAKRVAIHVPSHCALLDDAAAELGKEMAH-IAMSP---PR 219 Cupriavidus pin...
WP_011464143 147 G-----LECAIRVNPSQAVFAGTDDALSQAALALGAA-GAVCKRLDVRVASHSSWMAQAAHAFSDVLSA-LPFAA---PF 216 Albidiferax fer...
WP_011289735 145 G-----LAVAIRNAPRHLVVAGPLAGIVAVADKFAAAGASRLVHLAVQTPSHTPLLAKAAVEFGKRLDG-LPDRR---LA 215 Dechloromonas a...
WP_011050392 144 G-----AALAIINGDDHAVLGGPRAALQALGEAASAQGA-RVTLLPVGVPAHTPWLSAAAEGFAIELAT-AQLAA---PR 213 Xanthomonas
WP_003898052 146 Ra---tVWIANINAADQVVLGGTVDGLRDARAAARRMGARRFEMLDVAVASHGPVQARTATVIAERLAA-VPRRH---QS 218 Mycobacterium s...
WP_004546965 147 G-----AAVAIVNPGDAYVLAGPRAALDALAADARARGAARVTPVCVRVASHTHWLDAAVPRFRAALAG-ARIARapaPG 220 Burkholderia ps...
WP_003112670 220 VPYLSSSRARLV-AEPAALADDLAGNMARRVEWLATLRSAYERGARLHLELPPGRVLSGLARPLFGCAt--PAFEGSRAD 296 Pseudomonas
WP_011280413 218 IPIISATNGMKY-NDTNQGLNILSSQIDHPLDWYFCMENIEEYQPSMIIEIGPGNALSKMINNLLPHV---PCRSWDDFR 293 Psychrobacter a...
WP_004926789 218 IQYLSGTSARLL-RTNTQIMNDLAFNMSRMIDWHNTVQAAWERGARLQIEALPGTVLTSLARKIFKEG---TLLSFQNT- 292 Acinetobacter
WP_015961608 220 YPVISPLELNKI-YNAKQERALLAQELYTTLQWHKVCDLIGEYQYNLIIDLGPGDSMTTILNKANTELfntPLIIASHYN 298 Legionella pneu...
WP_011063988 220 LGYLSGSRARPM-RSVEALRDDLAFNMCRVVDWRGTVQSAYERGVRLQIELPPGAVLTGLARRVFAQG---TVIAFDGAR 295 Pseudomonas pro...
WP_011474987 220 AQYMTNRRARPT-RVLDRIREDVATNIAHPVRWHDSTEILVGLGTTLFVEINPGQVLSKLTTEAFPQV---PSIAMVAMP 295 Rhodopseudomona...
WP_011301045 220 LRYFSASLAREL-RDPRRIADDLALNMAVPVRWHETMLLAYATGARVVIEAPPGDVLTRLAQPVFADG---IVMAADRTR 295 Cupriavidus pin...
WP_011464143 217 CPIATNAYGVLS-RQPAELRQALGQQLACTVRWSSCMEALAERQVSCVLEIGAGSALARMWNERYPDI---PARSLDEFQ 292 Albidiferax fer...
WP_011289735 216 FPVLSAIDATAA-RTARPALDALARQICTPLDWAACLQAVREMQPDAVLEIGPGNALAKLFGELVPTI---PVRACDDFR 291 Dechloromonas a...
WP_011050392 214 LRVLAGIDARAV-GTQALVVDTLSRQIAQTVRWYDVLVQAAERGARVFLELGPGSALARMAREVLPAC---EARSVDEFH 289 Xanthomonas
WP_003898052 219 AAYLTNVGARRIvDDADAVLRDLAESVAKPVQWYDIAQVLPELGVQRTVEMPPGHVLTSL-------L---AAVPVTATS 288 Mycobacterium s...
WP_004546965 221 TRLLSGIDGAPV-LDVAAGADKLARQIAEPLDWAACVAGCVEAGARAFVELGPGRALAEMAAAAFPAL---PARSLADFR 296 Burkholderia ps...
WP_003112670 297 TLDALLR 303 Pseudomonas
WP_011280413 294 HADGLLE 300 Psychrobacter arcticus
WP_004926789 293 SIETLII 299 Acinetobacter
WP_015961608 299 SLKGLCN 305 Legionella pneumophila
WP_011063988 296 -LDTLQA 301 Pseudomonas protegens
WP_011474987 296 -FDYAVR 301 Rhodopseudomonas palustris
WP_011301045 296 -VDSLAA 301 Cupriavidus pinatubonensis
WP_011464143 293 GPKGAAQ 299 Albidiferax ferrireducens
WP_011289735 292 SVEGIVR 298 Dechloromonas aromatica
WP_011050392 290 STDGVLE 296 Xanthomonas
WP_003898052 289 VDDVGYA 295 Mycobacterium smegmatis
WP_004546965 297 SWDGVRA 303 Burkholderia pseudomallei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap