Conserved Protein Domain Family
one_C_dehyd_B

?
TIGR03129: one_C_dehyd_B 
formylmethanofuran dehydrogenase subunit B
Members of this largely archaeal protein family are subunit B of the formylmethanofuran dehydrogenase. Nomenclature in some bacteria may reflect inclusion of the formyltransferase described by TIGR03119 as part of the complex, and therefore call this protein formyltransferase/hydrolase complex Fhc subunit C. Note that this model does not distinguish tungsten (FwdB) from molybdenum-containing (FmdB) forms of this enzyme.
Statistics
?
PSSM-Id: 132173
View PSSM: TIGR03129
Aligned: 20 rows
Threshold Bit Score: 457.91
Threshold Setting Gi: 499264662
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011448960   7 NVGCPYCGCSCDDVRITVsdDG-KDILEVENVCAIGTEIFKHGCSKDRIRLPrMRQ-PDGSMKDISYEEAIDWTARHLLK 84  Methanospirillu...
WP_011033515   7 NIVCPVCGAACDDIQVEF--GD-GKI-EARNACKMGNAKFQEVVSSHRLRQP-LIK-VNGRLTAAAWDEALERAADILVS 80  Methanosarcina ...
WP_010876552   6 NVTCPVCGGSCDDIEVLY--DG--KTIKTRNACRMGNAKFQEMVSSHRILRP-QIK-TESGFRSAEWDEALDAAAEILTE 79  Methanothermoba...
WP_011170456   8 DIVCPVCGGTCDDIEVEY--DKeKRDIVVRNACKMGAAKFREIVSNHRITSP-KIR-INGKLEDSKWEDAIEKAAEILVN 83  Methanococcus m...
WP_011306553   5 NIVCPVCGAACDDIQVEI--KD-GKI-EAKNVCKMGIFRFNEITSPRRFKQP-FLK-FGGKLRPVSWDGALQIAADILSS 78  Methanosarcina ...
WP_011021262   5 NIICPACGAACDDIQVEF--K--NGAIEAKNICKVGNARFKALTSSRRLKQP-LIK-FEGKLKSVSWDEALEKAADILVS 78  Methanosarcina ...
WP_011405858  15 NCSCSYCGNNCDDITYLL--KD-DKIVGVRHACRLGASKIIN-DEDQRLLNP-MIRnKEGILKETTWENALDKIAQLLTN 89  Methanosphaera ...
WP_011032013   5 YYVCTGCGMLCDDIEVDV--EN-NKINKVYTACRIGVAHMKDGKESAAFL---------VDNKPVDETTAISEAATILKN 72  Methanosarcina ...
WP_011307858   5 YHVCTGCGLLCDDIEVES--EN-NSVNKVYTACRVGVAHMKEARKGEAD--------FLVDNKPVDEATAISEAASILKN 73  Methanosarcina ...
WP_010879146   2 IMICPGCSCLCDDIYI--------KDGKVFNACRRGEEIFAKYNENRAVAR--------VDGKEVDVDTAIEKAIEILKD 65  Archaeoglobus f...
WP_011448960  85 AKKPLMYGFGSTNCEGQAAAARVMEIAGGMLDNCATICHGPSFLAIFDNGYPSCTLGEVKNRADVIVYWGSNPAHAHPRH 164 Methanospirillu...
WP_011033515  81 AKRPLLFMGSETSCEAHEVGLKIGEYLGALVDSNATICHGPTAMGIQESGKVGATEGQKKNRGDLIVYWGTNPLESMPRQ 160 Methanosarcina ...
WP_010876552  80 SKRPTLFMGSEMSTEAMAAGLELGEYLNAMVDSNATICHGPTLMGIQEAGQSAATAGEIKNRADVIIYWGTNVMDSMPRH 159 Methanothermoba...
WP_011170456  84 AKRPLFFMGSETSCEAMTVGLHMGEYLGGIVDSNSTICHGPSLMGVQEAGKAGATAGETKNRADVVIYWGVNPMCSMPRH 163 Methanococcus m...
WP_011306553  79 AKRPLIFIGSETSCEAHKVGLMIGEHLGAIVD---TVGNGATVMGTQEAGRVGATEGQKKNRADLLVYWGANPLESMPRQ 155 Methanosarcina ...
WP_011021262  79 AKRPLLFMGSDISCETHEIGLRIGEYLGAVVDSNTTLGNGPAAMGLQESGKTAATEGQKKNRGDLVVYWGTNPLESMPRQ 158 Methanosarcina ...
WP_011405858  90 SVRPVLYGWGETSVEAIKEGIKIAQITGSVIDNQSTICHGATIQAFQNVGHPVMTLGAVKNRADVIIYVGTNPMDDHPRH 169 Methanosphaera ...
WP_011032013  73 AKNPLIFGLGTSSNEAQKLAIELAKKTSATLDDASSFSLGEVIEALLNNKTKVCTLDDVRNKADVSIFWGTDPSDSHPRQ 152 Methanosarcina ...
WP_011307858  74 ARNSLIFGLGTSTSETQKIAIELAKKINATLDDTSSFCLGPLAEALIQDKLKSCTLDDVRNKADVIIYWGTDPSDSHPRL 153 Methanosarcina ...
WP_010879146  66 AKNPAIYGLDTTVVEAQSLAIEVAEKLNGYIDDNSSFCLGELVEAVLKGEIPTTTLDEVRDNAYVLVYWGTNPYHSLSRH 145 Archaeoglobus f...
WP_011448960 165 MSRYSIFPRGFFTGKG-QKKRTVIVIDPRFTDTANVA-DYHLQVKQGHDYELFNAFRMVIHGHGkDL--P--DEVAGIKK 238 Methanospirillu...
WP_011033515 161 MSRYGVFPRGYWTKRG-RFDRTVITVDPRKTPTTEAS-DLHVQLKPGSDYELISALLTLLHGKT-PH--PsvEEITGVPI 235 Methanosarcina ...
WP_010876552 160 MSRYSIFMRGFFRERG-KKDRTVISVDPRETATTKAS-DIHLQLKPNSDYELFSALLTVIRGNE-PHrsI--ESITGISV 234 Methanothermoba...
WP_011170456 164 MSRYAVFPRGYFVQKG-RKERKVITVDPRVSETAKGS-DIHLQLKPSTDYELFSALMLAVKGKP-IH--PsiEQVTGISV 238 Methanococcus m...
WP_011306553 156 MSRYGVFPRGYWTKRG-RFDRTIITVDPRKTLTARAS-DLHVQLKPGSDYELISALLTLLHGKT-PHhsV--EEITGVSI 230 Methanosarcina ...
WP_011021262 159 MSRYGVFPRGYWTGRG-RFDRTVITVDPRKTLTSEAS-DLHVQLKPNSDYELISGLLTLLHGKT-PH--PsiEEVTGIPI 233 Methanosarcina ...
WP_011405858 170 LSRYTTFPEGFFRPNG-REDRTIITIDPKYTNTAKVS-DKWISYDIGEDYAFFNTLRMILAGHE-IT--D--EEIAGVNI 242 Methanosphaera ...
WP_011032013 153 LSKYAYFPRGTEKQRGwEEERTAICIDVRKSHTAKICgNYFFQIPPGGDAEFIDALIAALAGKL-P------KTSYNFPP 225 Methanosarcina ...
WP_011307858 154 LSKHSYFPRGTEKQRGwEEERTAIAIDVRKSHTAKICgNYFYQIPPKGDAEFIDAMIAGLSGKL-P------KTSYNYPP 226 Methanosarcina ...
WP_010879146 146 MSKYTYYPRGKRRPRGyDEDRYLVVVDVRKSETAKLAkKNAKFIQVESDAELVDSFMKVVDGKA-AK--Y--AKEAG--- 217 Archaeoglobus f...
WP_011448960 239 ETILEVAEIMKNARFGTTFFGMGLTHTDGRNHNIDIAISLTRDLNKISKWTIMAMRGHYNIAGPGVVWSWTFGFPYCLDL 318 Methanospirillu...
WP_011033515 236 PVMEEMLDMMKNCNFGAISVGLGLSSSIGKHRNAEIAMNLVKELNNYAKFTLGALRGHCNVAGFNQVASYMYGYPFGLDF 315 Methanosarcina ...
WP_010876552 235 ETIKEVADIMLNAQFGAIYGGLGLASSEGKHRNVEMVLKLVAALNEHTKFTIGAIRGHCNVAGFNQVASWEYGFPFGVDF 314 Methanothermoba...
WP_011170456 239 EKILEVAQIMKNAKFGSIYGGLGLASSFGKHRNLECVLTLNKELQKYAKFQIGLIRGHCNVAGFNVLASYLYGFPFGVDF 318 Methanococcus m...
WP_011306553 231 SVMEEMLGIMKNCNFGTISVGIGLSSSLGKYRNIEIAMNLVKELNNYSKFTIGIIRSHCNAAGFTQVASYMYGYPFGLDF 310 Methanosarcina ...
WP_011021262 234 FLMERMLYMMKNCNFGSISVGVGLSSSIGKHRNVEIAMNLVKELNNYTKFTLGVLRSHCNAAGFNQIASGMYGYPFGLDF 313 Methanosarcina ...
WP_011405858 243 EILYELVEIMKNAEYGALFFGLGLTQSTTKQGNVDVLIQLIEDLNKYSKWSMLPMRGFFNVNGFNMALTTETGYPYGVDY 322 Methanosphaera ...
WP_011032013 226 KRILELANILKGAKFGVVFAGRGLVYSL---DNLEPLIRLMNALNEKANFHLVPMIRQYNTRGFNENLFKETGYVNSVKF 302 Methanosarcina ...
WP_011307858 227 KKILELANILKGAKFGVIFVGRGLIYSL---ENLEPLFKLMKILNEKANFHLIPMVSSSNTMGFNENLFAETGYVNSVKF 303 Methanosarcina ...
WP_010879146 218 ----AIITEMKKADFNVIFGGLGLKYGL---KDLNMFKEMVKKLNEVAKVYFIPAGFHGNMRGFNETLFEKVGYVNKYSF 290 Archaeoglobus f...
WP_011448960 319 TKQnHAHMNPGETSSVDMAMRDEVDMFINIGTDAAAHFPIPAVKQLKKHPWVTIDPSINMASEISDLHIPVCICGVDVGG 398 Methanospirillu...
WP_011033515 316 MRG-HPRYNPGEYTTVDVLREKDVDAAFVMCADLVCHIPADCASYLAEIPMVCLDIAPCPSTAASDVVLPGVIDAMECDG 394 Methanosarcina ...
WP_010876552 315 TRG-YPRYNPGETTIVDLLQRKESDAVLVICSDLGAHLPKECVEYMKEIPVICIDIAPCPTTLVSDVVIPGVIDAMESSG 393 Methanothermoba...
WP_011170456 319 SRG-YPRYNPGEHTTTDVLREKEVDAVFVMCADLGAHLAQDSVRYMHDIPVICLDIAPCPSTSVANVVLPGVIDALECDG 397 Methanococcus m...
WP_011306553 311 MRG-HPRYNPGEFTTVDLLREKDVDAAFVICSDLLSQIPTDCADYLAEIPLICLDTVPCPTTSISDIVLPGVIDSIECEG 389 Methanosarcina ...
WP_011021262 314 MKG-YPRYNPGEFTTADLLRERDVDAVFVIGTDLLNEVPADCAAYLSEIPLICLDIVPCPTIIVSDVVLPAVIDAMECDG 392 Methanosarcina ...
WP_011405858 323 SRG-YPRYMVGETTTIDLLNRREPDFFMAVAADPGVQFPGYTIKHLVDIPVVQVDTHWGPYTELADIVLPSTRVGVETKG 401 Methanosphaera ...
WP_011032013 303 EDG-TVKHGP-EYSVVESLKEKTVDAALIIGSDPFSILPRSIAKNLLEVPVIVLDPCETLTSRNAKVYISTAIDGVESGG 380 Methanosarcina ...
WP_011307858 304 ENG-TAKHGP-EYSVVESLKAKTVDAALIIGSDPLLFLPGSIAKNMLEIPVISMDHCETLTSKHSKVYINTAINGVEAGG 381 Methanosarcina ...
WP_010879146 291 RDG---KSGE-EFAFTELLKNEKIDAALIVGTDPVYSLPFDVSSKLGKVKTIVIDPRMSFTARIADVVIPSAISGIEAGG 366 Archaeoglobus f...
WP_011448960 399 IVYRMDNVPIQFRKVIEPPEg-vM---DDETLLNKIADRM 434 Methanospirillum hungatei
WP_011033515 395 TFYRLDDVAVHFEPFTSSPFeftK---SNEDTLKQLFEKI 431 Methanosarcina mazei
WP_010876552 394 TFYRFDNVPIHHKAFTTSPF---PeteSNEHTLRQILERV 430 Methanothermobacter
WP_011170456 398 TFYRFDEIPIYYKPFTQSPFdftK---SNEDTMEQLFekv 434 Methanococcus maripaludis
WP_011306553 390 TFYRLDDVPIYFEPFLDSPF---KftqSNEDTLKQLFEKI 426 Methanosarcina barkeri
WP_011021262 393 TFYRLDDVAVHFEPFMDSSFeftK---SNEDTLKQLFVKI 429 Methanosarcina acetivorans
WP_011405858 402 TAYRMDSIPLYMKKVIEKPEn-cH---SDQWILSQIYNRI 437 Methanosphaera stadtmanae
WP_011032013 381 SAIRMDGVKVDFKPAVETKR---P---SDETVLKKIMEAL 414 Methanosarcina mazei
WP_011307858 382 SSIRMDRVKVSFEPVIETNH---P---SEDVILKKIMEAL 415 Methanosarcina barkeri
WP_010879146 367 TMVRSDGVRVMLEPLEEK-E---V---NDVYILQRIKEGL 399 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap