3F4W


Conserved Protein Domain Family
RuMP_HxlA

?
TIGR03128: RuMP_HxlA 
Click on image for an interactive view with Cn3D
3-hexulose-6-phosphate synthase
Members of this protein family are 3-hexulose-6-phosphate synthase (HPS), or the HPS domain of a fusion protein. This enzyme is part of the ribulose monophosphate (RuMP) pathway, which in one direction removes the toxic metabolite formaldehyde by assimilation into fructose-6-phosphate. In the other direction, in species lacking a complete pentose phosphate pathway, the RuMP pathway yields ribulose-5-phosphate, necessary for nucleotide biosynthesis, at the cost of also yielding formaldehyde. These latter species tend usually have a formaldehyde-activating enzyme to attach formaldehyde to the C1 carrier tetrahydromethanopterin. In these species, the enzyme is viewed as a lyase rather than a synthase and is called D-arabino 3-hexulose 6-phosphate formaldehyde lyase. Note that there is some overlap in specificity with the Escherichia coli enzyme 3-keto-L-gulonate 6-phosphate decarboxylase.
Statistics
?
PSSM-Id: 132172
View PSSM: TIGR03128
Aligned: 9 rows
Threshold Bit Score: 265.388
Threshold Setting Gi: 500012815
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3F4W_A         2 KLQLALDELTLPEAMVFMDKV-V-DDVDIIEVGTPFLIREGVNAIKAIKEKYPHKEVLADAKIMDGGHFESQLLFDAGAD 79  Salmonella ente...
WP_010961944   5 LIQLALDSLDRDRTLELARVT-A-PYVDIFEIGTPCIKYNGIEIVRELKRRHPDRLVLVDLKTMDAGEYEAAPFYAAGAD 82  Methylococcus c...
WP_010962231   5 LIQLALDTLDIPQTLKLASLT-A-PYVDIFEIGTPSIKHNGIALVKEFKKRFPNKLLLVDLKTMDAGEYEATPFFAAGAD 82  Methylococcus c...
WP_010978182  13 NLQVALDFIDLKNAEEIAKQSiE-AGADILEVGTPLIKSYGIQGIRRIREIAKERIVLADTKTADAGDVEAEIVHLGGGN 91  Sulfolobus toko...
WP_003246452   2 ELQLALDLVNIPEAIELVKEV-E-QYIDVVEIGTPVVINEGLRAVKEIKEAFPQLKVLADLKIMDAGGYEIMKASEAGAD 79  Bacillus subtilis
WP_000422861   2 ELQLAIDLLNKEDAAELANKV-K-DYVDIVEIGTPIIYNEGLPAVKHMADNISNVKVLADMKIMDAADYEVSQAIKFGAD 79  Staphylococcus ...
WP_011248190   2 KLQLALDRLDWETCFALVEDT-S-DAIDIIEIGTGVIKEYGMEIVRQMRKAFPRHTLLADMKICDAGKHEARQAFAAGAD 79  Bacillus clausii
WP_011249430   2 ILQVALDLTDIEQAISIAEKA-ArGGAHWLEVGTPLIKKEGMRAVELMKRRFPDRKIVADLKTMDTGALEVEMAARHGAD 80  Thermococcus ko...
WP_011693533   2 KLQVAMDVLTVEAALELAGKV-A-EYVDIIELGTPLVKNAGLSAVTAVKTAHPDKIVFADMKTMDAGELEAEIAFGAGAD 79  Arthrobacter sp...
3F4W_A        80 YVTVLGVTDVLTIQSCIRAAKEAGKQVVVDMICVDDLPARVRLLEEAGADMLAVHTGTDQQAAGRKPIDDLITMLKVRRK 159 Salmonella ente...
WP_010961944  83 ICTVLGVSGPATIAGVVKAAQAHNAEVQVDLINVPDKAACAREAARLGAQIIGVHTGLDAQAQGQTPFADLESIARLKLP 162 Methylococcus c...
WP_010962231  83 ITTVLGVAGLATIKGVINAANKHNAEVQVDLINVPDKAACARESAKAGAQIVGIHTGLDAQAAGQTPFADLQAIAKLGLP 162 Methylococcus c...
WP_010978182  92 IMTVLGIMDDATIESAVKKAHEYGILVQADLINVKDILKRAEEIKRLGVDIIGLHVGLDVQKKRGITISDLKNEIKKVSE 171 Sulfolobus toko...
WP_003246452  80 IITVLGATDDATIKGAVEEAKKQKKKILVDMINVKDIESRAKEIDALGVDYICVHTGYDLQAEGKNSFEELTTIKNTVKN 159 Bacillus subtilis
WP_000422861  80 VITILGVAEDASIKAAIEEAHKNNKQLLVDMIAVQDLEKRAKELDEMGADYIAVHTGYDLQAEGQSPLESLRTVKSVIKN 159 Staphylococcus ...
WP_011248190  80 IATVMAFAPAATIAETLSVASQEGKEMMVDLLGV-DKTEQVKALKEQGVSFVGLHLGKDEQQHKQLG----QGLFQLVEG 154 Bacillus clausii
WP_011249430  81 VVSILGVADDKTIKDAVEVARRYGIRVMVDLIGVKDKVKRAKELEKMGVHYILVHTGIDEQAQGKNPLEDLEKVVKAVKV 160 Thermococcus ko...
WP_011693533  80 LVSVLGSADDSTIAGAVKAAKAHNKGIVVDLIGVADKVTRAKEARALGAKFIEFHAGLDEQAK---PGYNLNLLLSAGEE 156 Arthrobacter sp...
3F4W_A       160 A--R--I--AVAGGISSQTVKDYALLGPDVVIVGSAITHAADPAGEARKISQVL 207 Salmonella enterica subsp. enterica serov...
WP_010961944 163 V--R--I--SVAGGINQNTASRVAKAGADIVVVGAAIYGAPCPATAARTIRELL 210 Methylococcus capsulatus
WP_010962231 163 V--R--I--SVAGGIKASTAQQVVKTGANIIVVGAAIYGAASPADAAREIYEQV 210 Methylococcus capsulatus
WP_010978182 172 L--GviV--SVAGGLNKNNIVDIIDLPINIYVVGGAITRAKNPLEEAKQIVKII 221 Sulfolobus tokodaii
WP_003246452 160 A--K--T--AIAGGIKLDTLPEVIQQKPDLVIVGGGITSAADKAETASKMKQLI 207 Bacillus subtilis
WP_000422861 160 S--K--V--AVAGGIKPDTIKDIVAESPDLVIVGGGIANADDPVEAAKQCRAAI 207 Staphylococcus aureus
WP_011248190 155 TglK--T--AIAGGVTVESLPVILPYRPDVIIVGSGVTKAEKPKEAAMHIKKRI 204 Bacillus clausii
WP_011249430 161 P--V--A--V-AGGLNLDTIPKVIELGATIIIVGSAITKAKDPEEVTRRIIDLF 207 Thermococcus kodakarensis
WP_011693533 157 A--R--VpfSVAGGVNLSTIEAVQRAGADVAVVGGSIYSAEDPALAAKQLRAAI 206 Arthrobacter sp. FB24
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap