1Y5Y


Conserved Protein Domain Family
one_C_fae

?
TIGR03126: one_C_fae 
Click on image for an interactive view with Cn3D
formaldehyde-activating enzyme
This family consists of formaldehyde-activating enzyme, or the corresponding domain of longer, bifunctional proteins. It links formaldehyde to the C1 carrier tetrahydromethanopterin (H4MPT), an analog of tetrahydrofolate, and is common among species with H4MPT. The ribulose monophosphate (RuMP) pathway, which removes the toxic metabolite formaldehyde by assimilation, runs in the opposite direction in some species to produce ribulose 5-phosphate for nucleotide biosynthesis, leaving formaldehyde as an additional metabolite. In these species, formaldehyde activating enzyme may occur as a fusion protein with D-arabino 3-hexulose 6-phosphate formaldehyde lyase from the RuMP pathway.
Statistics
?
PSSM-Id: 132170
View PSSM: TIGR03126
Aligned: 13 rows
Threshold Bit Score: 229.932
Threshold Setting Gi: 497720439
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Y5Y_A         6 VQVGEALVGDG--NE---VAHIDLIIGPRGSPAETAFCNGLVNNKHGFTSLLAVIAPNLPCKPNTLMFNKVTINDARQAV 80  Methylobacteriu...
AAB85949      26 YRIGEALIGSG--NE---VAHIDLIIGDKEGNAGAAFANGLTNLSLGHTPLLSVVRPNLMTKPATLIVPKVTVSCLEDAD 100 Methanothermoba...
WP_011033226   2 FQIGEALMGQG--SE---LAHVDLMIGDKGGPVGQAFANGLTQLSAGHTPLLSVIRPNLPPKPSTLIIPKVTVKNMDQAA 76  Methanosarcina ...
WP_011407066   5 YEIGEALIGDG--PE---LAHIDLIVGSKQGPVGTAFATNMASMSVGHTPLLSVIRPNLPTKPATLIVPKVTVQNLDDAS 79  Methanosphaera ...
WP_011022945  11 SMIGEALIGTG--PE---IAHIDLIIGPRGGPVETAFMNSLAMPRQGHTPLLAVLEPNVQPKPVTLLVNKVTIKNVAQAA 85  Methanosarcina ...
WP_011307040  18 SMVGEALIGSG--PE---VAHIDLVIGPRGGSVEAAFMNSLAMPRQGHTPLLAVLEPNIQPKPTTLIVNKVTIKNVSQAA 92  Methanosarcina ...
WP_010962061   7 LLVGEALCGGG--NE---IAHIDLIMGPRGSAAETAFANTLTNNKDGFTSLLAVVAPNLLCKPNTVMFNKVTIKNGKQAT 81  Methylococcus c...
WP_003604760   7 VQVGEALVGDG--NE---VAHIDLIIGPRGSPAETAFCNGLVNNKHGFTSLLAVIAPNLPCKPNTLMFNKVTINDARQAV 81  Methylobacteriu...
WP_011122706  34 FHIGESLVGDG--NE---ISHIDLMIGSKDGPVGMAFANALANQSEGHTNLLAVLEPNVAVKPSTVMVTKVTIKGMKQAV 108 Rhodopirellula ...
WP_010878802   3 FRIGEALIGEG--FE---VAHVDLIIGTKDSPAGIAFANALANLSAGHTPLLAVLRPNLITKPPAVIVPKVTVKDMHQAE 77  Archaeoglobus f...
WP_011448624   2 YLIGEALIGEG--SE---LAHVDLIVGDKNGPVGMAFANALSQLSAGHTPLLAVVRPNLLTKPATVVIPKVTLKNEGQVN 76  Methanospirillu...
WP_010034623   4 MYVGEGLVIEG--SDldnVAHIDLLIGPKDGPVGVAFANALASQTAGHTNLLAVVSPNIPAKPATVTVTKVTMKKSAQVM 81  Gemmata obscuri...
WP_011019643   5 LRVGEAFVGEPdePE---IAHIDLVMGSVEGPVGRAFAEALASPSKGHTPLLAVLTPGVAVRPPTLITPTVTIENMAQGE 81  Methanopyrus ka...
1Y5Y_A        81 QMFGPAQHGVAMAVQDAVAEGIIPADEADDLYVLVGVFIHWEAADDAKIQKYNYEATKLSIQRAVNGEPKASVVTEQRKS 160 Methylobacteriu...
AAB85949     101 KVFGPAQTAVARAVADSVEEGIIPEEKAEDLVVIVSVFIHPEAEDYRKIYQYNYGATKLALRRAMEGYPSVRKVLSEKDR 180 Methanothermoba...
WP_011033226  77 RIFGPAQSAVAKAVADSVEEGVIPKDQVEDLVIVASVFIHPEAQDYNKIYRYNYGATKLAIKRALEGFPDIDTVLEESNK 156 Methanosarcina ...
WP_011407066  80 KIFGPAQTAVGRAVADAVEEEIIPKDIVEDIVLMVNVFIDPSAKDYRKIYQYNYGATKLAIKRAFDKYPSVDKVLAEKDR 159 Methanosphaera ...
WP_011022945  86 LMFGPAQAAIAKAVMDSVAAGILPEEQADDIFIIVSVFIEWDAKDKDKVYEYNYEATKLAIARAMGNKPTVKEALAKKDS 165 Methanosarcina ...
WP_011307040  93 LMFGPAQAAVAKAVMDSVADGVLPEEQADDIFIIVSVFIEWDAKDKDKVYEFNYEATKLAIARAMEGRPTVEEALAKKDS 172 Methanosarcina ...
WP_010962061  82 QMFGPAQRGVAMAVADCVEDGTIPADEADDLFICVGVFIHWLAEDDAKIQDYNYEATKLAIKRAVAGEPKAADVVARKGS 161 Methylococcus c...
WP_003604760  82 QMFGPAQHGVAMAVQDAVAEGIIPADEADDLYVLVGVFIHWEAADDAKIQKYNYEATKLSIQRAVNGEPKASVVTEQRKS 161 Methylobacteriu...
WP_011122706 109 QMFGPAQAAVAQAVADAVSEGIIPKDQCEDLVCVCGVFIHPAAEDDEKIYKYNYEATKDALKSAMQGKPSADDMLAKKDT 188 Rhodopirellula ...
WP_010878802  78 LIFGPAQAAVAKAVADAVEEGIIPRERADEYVVVASVFIHPNAKNKHKIYYYNYGATKLAIKRAMQNFPDVDTVLYEKDR 157 Archaeoglobus f...
WP_011448624  77 QMFGPVQAAVAKAVADAVEEGLFGDININDICILASAFLHPSAKDYNRIYRYNYGATKLAISRAFEEFPDEKTLIHEKDR 156 Methanospirillu...
WP_010034623  82 QMFGPAQAAVARAVVDSVVEGVLPKAEAENWVIVCGVFIAPSANDNKKIYKNNYEAVKLAIKNAIQKSPSIDEIIAKKDT 161 Gemmata obscuri...
WP_011019643  82 KIFGPVQRGIAEAVVESVEEGIIPRDIVDDVVIIANTFVHPEAEDDRRLYENNKEAMKKAIECAMKGEPTIDELIEKKDE 161 Methanopyrus ka...
1Y5Y_A       161 ATHPF 165 Methylobacterium extorquens AM1
AAB85949     181 GSHPI 185 Methanothermobacter thermautotrophicus str. Delta H
WP_011033226 157 STHAI 161 Methanosarcina mazei
WP_011407066 160 GTHPI 164 Methanosphaera stadtmanae
WP_011022945 166 AKHPF 170 Methanosarcina acetivorans
WP_011307040 173 ANHPF 177 Methanosarcina barkeri
WP_010962061 162 EAHPF 166 Methylococcus capsulatus
WP_003604760 162 ATHPF 166 Methylobacterium extorquens
WP_011122706 189 AAHPF 193 Rhodopirellula baltica
WP_010878802 158 SFHPF 162 Archaeoglobus fulgidus
WP_011448624 157 AAHAV 161 Methanospirillum hungatei
WP_010034623 162 P-HPF 165 Gemmata obscuriglobus
WP_011019643 162 VEHPL 166 Methanopyrus kandleri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap