Conserved Protein Domain Family
citrate_citG

?
TIGR03125: citrate_citG 
triphosphoribosyl-dephospho-CoA synthase CitG
Triphosphoribosyl-dephospho-CoA is transferred to, and becomes the prosthetic group of, the respective acyl carrier protein subunits of both citrate lyase and malonate decarboxylase. Members of this protein family are triphosphoribosyl-dephospho-CoA synthases specifically from citrate lyase systems. This protein sometimes occurs as a fusion protein with CitX, the phosphoribosyl-dephospho-CoA transferase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 132169
View PSSM: TIGR03125
Aligned: 16 rows
Threshold Bit Score: 384.293
Threshold Setting Gi: 489643335
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O30827        35 EQIAELAYQALIKEARLTPKPGLVDSTNNGSHQDMSLSTFEQSAIALRPFFTQFVLMGIETTNLPDSHILSKIRPLGLQA 114 Haemophilus duc...
WP_011464690  20 EAIGRLAERSLVLELELTPKPGLVDRANSGAHRDMDVGTFRASIAAISPWFSFFFERGVDGSAVPVEDFLRYIRADGMAC 99  Albidiferax fer...
WP_002263234   8 aSLSYLAVKSLLYELNLTPKPGLVDCHNNGAHNDMDFYTFLDSILSLSPFFKKYIEVGWLYHNESPQYLFNQLRKLGIEA 87  Streptococcus m...
WP_010922323   7 TSISQLALKALLYEVSLSPKPGLVDRFDNGAHDDMSFITFIDSMIALSPFFQAYIETGFAYAKEEPLLLFNRLRQLGQKA 86  Streptococcus p...
WP_000062434  19 DEYALLGWRAMLTEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHGLRPIGMAC 98  Escherichia coli
WP_017441577  20 gELNGLVARALLTEARLTPKPGLVDIRNSGAHRDMDLAAFERSTTAIAPWMEKFFIMGNNTAALAAENVLVMLRPLGMAC 99  Salmonella ente...
WP_011101256   4 KIIVNHALRALLYEVTVNPKPGLVDPLSAGPHPDMNAFMFIDSALSLAPYFNACAAAGVAYTAVDLTGLFKQIRGIGVQA 83  Lactobacillus p...
WP_011017110   6 KEVAKLATKALLYEVSISPKAGLVSRLSNGSHKDMDFYTFIDSVLSLSYYFSECYTYGQENNFYSP-NFFKNLRDLGKKA 84  Fusobacterium n...
WP_003547775   2 TQIVTNAIKALLYEVVTLPKPGLVDPSDIGPHPDMDVYMFINSSLSLREYFNKAEEIGITY-ETDLKKVFEQLRIQGRIA 80  Lactobacillus a...
WP_011374917   6 KAIAILAYQSLIAEVQLAPKPGLVDPESNGAHDDMDYPLFLKSIAALKAYLLAYIEAG--YQSTSDQQLFLTLRQIGQDA 83  Lactobacillus s...
O30827       115 EQAMFVATNQVNTHKGAIFAFGLVCTALGRH-----FSRwqnkmmsSPSFEisqdttgISL----------ISETVARFT 179 Haemophilus duc...
WP_011464690 100 ERAMFAATLGVNTHKGSVFSFGLLCAAAGRL-----HGR-------GRPLS-------RAS----------VCAEVSHIC 150 Albidiferax fer...
WP_002263234  88 EAAMFSATERVNTHKGINFSFALLLGATGSY-----LAK-------HIELI-------QEKrrfmpqdsltICHLAGEMS 148 Streptococcus m...
WP_010922323  87 EETMFCATQGINTHKGLNFSMALLLGATGAY-----LAR-------TPHLM-------TDLgrfskedtlaICRLVKPMT 147 Streptococcus p...
WP_000062434  99 EGDMFRATAGVNTHKGSIFSLGLLCAAIGRL-----LQL-------NQLLT-------PTT----------VCSTAASFC 149 Escherichia coli
WP_017441577 100 ENDMLQATNGVNTHRGAIFAFGLLSAAIGRL-----LAR-------GEPLE-------QNR----------ICDQVARLS 150 Salmonella ente...
WP_011101256  84 EQTMFAATKGVNTHKGAVFSLGVLVTAAAYQ-----LQ--------HPDVD-------LAT----------I---VRTML 130 Lactobacillus p...
WP_011017110  85 EKEMYQATNGVNTHKGTIFSMGILISVLASH-----LKE-------VDKID-------LKI----------LSQKIKNMC 135 Fusobacterium n...
WP_003547775  81 EKIMFHTTSGVNTHKGAIFSLGIFVCAES-------YAR-------FNNVD--------------------TFSVIRKMC 126 Lactobacillus a...
WP_011374917  84 EKQMLLATSQINTHKGANFSYALILGAIGRAsqtltLSE-------LVNLN-------FKP----------VFEIVRDMT 139 Lactobacillus s...
O30827       180 QGITD-ELKNYSKNQP--LTAGITLYQQYGFTGARGEAEKGFPLVQQAV-VFIL-----SQAESEMRWYWALLYLMANNN 250 Haemophilus duc...
WP_011464690 151 AGLVKrEL--LLPAAA--RTAGELLYWQHGLTGARGEAQSGFATACAHGvVPYLla-raKGMDEERSLFEALLQLMAHNR 225 Albidiferax fer...
WP_002263234 149 MHLIQnDLSHVETKRN--LTYGEKLFLQYGLKGLRGEASQGYPSLTQKA-LPFFrnellKKQDIQISQLKLLLYLMTFIE 225 Streptococcus m...
WP_010922323 148 AHLIQtDLGHLNTKKE--FTYGEQLFVTYGIKGPRGEASEGFTTLTDHA-LPYFrq-miSQNDPETSQLRLLVYLMSIVE 223 Streptococcus p...
WP_000062434 150 RGLTDrELR--TNNSQ--LTAGQRLYQQLGLTGARGEAEAGYPLVINHA-LPHYltlldQGLDPELALLDTLLLLMAING 224 Escherichia coli
WP_017441577 151 RNIVAhELSAKK-AGK--LTKSETHFQCYGLSGARGEAESGFRTVRTQA-LPVFnrvvqEHDDTHLALLQTLLHLMAWND 226 Salmonella ente...
WP_011101256 131 AGLTAnDFNDLNTKDPttLTAGERQYLTYGIKGIRGEAEAGYPTVMQVA-LPALr---rSRGTINQRLLDTLMAIVQATV 206 Lactobacillus p...
WP_011017110 136 SSLID-ELENINN--F--STYGEKAFKNYHLTGARGLALSGYDIVLLDG-INKLke-ftKSLDFETSCILLLFYYISLLD 208 Fusobacterium n...
WP_003547775 127 QGLVKnDLQ--KNNQN--LTAGEQQFIQYGQGGARQVAQEGYPIIEKIA-LPFLk---nRQGTTNQRLLDTLMKIATVIE 198 Lactobacillus a...
WP_011374917 140 KGLVSrDFSQIASKVQ--LSYGEQLYVEYGFTGIRGEAEAGYPSLEYVA-LPTLqk--yRMLPEDDRHLILMLTLMTEVQ 214 Lactobacillus s...
O30827       251 DTNIVHR-GGINGLQFIQDEAHKRLGNAKNLQnaNALMASLREFDDDCIARNLSPGGSADLLALTIFFLSL 320 Haemophilus ducreyi 35000HP
WP_011464690 226 DTNIVSR-GGMEGLCLVQAEARRLLDCPTPSR--SARTAQLAAFDQLLIERNLSPGGSADLLAVSWFLANL 293 Albidiferax ferrireducens
WP_002263234 226 DSNIIHR-GGIKSWKKVQQEAQTLLEKDLPPY--Q-LKEQLNSYNQILTDRHLSPGGAADLLSLTLYFSFL 292 Streptococcus mutans
WP_010922323 224 DGNLIHR-GGIEAWKGVKADMRLLLQQDLS-T--TDLRLALSSYNQCLINQHLSPGGAADLLALTFYFAFL 290 Streptococcus pyogenes
WP_000062434 225 DTNVASR-GGEGGLRWLQREAQTLLQKGGIRT--PADLDYLRQFDRECIERNLSPGGSADLLILTWFLAQI 292 Escherichia coli
WP_017441577 227 DTNLVSR-GGLEGLYYVQQQAQKLLWQGGVLV--EGGIEAMQSLDDELILRNLSPGGSADLLAVTWFLSHF 294 Salmonella enterica
WP_011101256 207 DTNLVKRaHDPHVIDWVHDQAHRYFDLGGSRS--EAGMAFLRELNQIFVDHNYSLGGSADLLILTIFIGLQ 275 Lactobacillus plantarum
WP_011017110 209 DTNIVNR-TNFETLKEIQILCKNLYEENVKSLskEKIRNEMSKLNDIFIEKNISAGGSADLLILTIFIHFI 278 Fusobacterium nucleatum
WP_003547775 199 DSNLIKRaGNIEVINWLHQSAEKYLRLGGAET--KTGLAYLDELNKVFKENNYSLGGCADLLIVTIFMALe 267 Lactobacillus acidophilus
WP_011374917 215 DMNLVHR-GGIDGWQMVQKAATVILQETDNML--L-VKRKLRQLDTELIEAHISPGGTADLLSLGIFFERL 281 Lactobacillus sakei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap