3C0B


Conserved Protein Domain Family
one_C_unchar_1

?
TIGR03123: one_C_unchar_1 
Click on image for an interactive view with Cn3D
probable H4MPT-linked C1 transfer pathway protein
This protein family was identified, by the method of partial phylogenetic profiling, as related to the use of tetrahydromethanopterin (H4MPT) as a C-1 carrier. Characteristic markers of the H4MPT-linked C1 transfer pathway include formylmethanofuran dehydrogenase subunits, methenyltetrahydromethanopterin cyclohydrolase, etc. Tetrahydromethanopterin, a tetrahydrofolate analog, occurs in methanogenic archaea, bacterial methanotrophs, planctomycetes, and a few other lineages. [Central intermediary metabolism, One-carbon metabolism]
Statistics
?
PSSM-Id: 163144
View PSSM: TIGR03123
Aligned: 11 rows
Threshold Bit Score: 426.774
Threshold Setting Gi: 499725253
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3C0B_A         3 LGIDIGGANTKIT--ELHENGEFK---V--HH--LYFPXWKNNDKLAEVLKTYS-N--D-VSH----VALVTTAELADSY 65  Methanococcus m...
WP_011170016   3 LGIDIGGANTKIT--ELHENGEFK---V--HH--LYFPMWKNNDKLAEVLKTYS-K--D-ISH----VALVTTAELADSY 65  Methanococcus m...
WP_002813371   9 SGWDIGGAHLKAA--LTDSQGRIAa--C--IQ--LPCPLWQGLEKLQQAFSQMQ-L--E-LKNkdclAAITMTGELADLF 76  Nitrosococcus o...
WP_010876467   4 AGFDIGGANTDMAiiDFGSDGDMKe--VrvDF--RYLPMWLRKDELAETLLEMVgD--D-LHEle-gVGVCMTAELVDAY 75  Methanothermoba...
WP_011018485  14 LGLDVGGAHTDAAlvRYDEDGKVMvlgT--DR--VYLPMWKKKKRLKKTIKRIV-H--K-FKPd--vVGLTMTGELADAF 83  Methanopyrus ka...
WP_011034428  38 IGIDIGGANTKLA----SSDGTI----V--EL--HYLPLWKNT-MLPEVLKEIS-Q--R-LKPe--nVAVVMTGELADCF 98  Methanosarcina ...
WP_003604764   9 IGWDLGGVHVKAA---LVEEGRVVe--A--VQ--APCRLWRGVPALDETFAQLP-D--W-VRGea-aHAVTMTGELTDCF 74  Methylobacteriu...
WP_011447618   2 IGVDIGGANLKVV----DEAG------A--HI--HYCPLWKETP-----IREIL-Q--D-YSSad-nAAVVMSGELADCF 57  Methanospirillu...
WP_011405987   4 MGLDIGGANTDCAiiEINDEKQIKs--I--KKskEYLPMWIENDKLPECLLKLS-Q--DdLDSid-vVCVTMTAELADSY 75  Methanosphaera ...
WP_010877986  44 LGIDIGGANLKVA----SKDG------W--EI--IYFPMWREAERLEGKLREIA-E--K-YSTa--kAGVVMTAELADFF 103 Archaeoglobus f...
WP_010962064   6 VGWDIGGAHLKAV--ALTDTGAIAd--V--RQ--YPCPLWLGLERLESALSEAV-NelG-IDSsc-rHAVTMTGELTDHF 74  Methylococcus c...
3C0B_A        66 ETKKEGVDNILNAAESAFGS-N-ISVFDSNGNFISLESAK-TNNXKVSASNWCGTAKWVSKN-IEEnCILVDXGSTTTDI 141 Methanococcus m...
WP_011170016  66 ETKKEGVDNILNAAESAFGS-N-ISVFDSDGNFISLEGAK-TNYMKVSASNWCGTAKWVSKN-IEEnCILVDMGSTTTDI 141 Methanococcus m...
WP_002813371  77 NDRDEGVIKILEYASQHFQNiP-VYVFAGTQGFISLEQAA-KYTEAIASANYLATSQLAARH-WKE-GLFLDIGSTTSDL 152 Nitrosococcus o...
WP_010876467  76 PSKAAGVADIIDRVEGAFDV-P-VAYVSLSG-MVDASEAL-ADPMNIAAANWVATSQIASAM-SSD-CIMVDVGSTTTDI 149 Methanothermoba...
WP_011018485  84 NTRREGVEYIVRTVTSACHA-P-VYVVTSDGSTVPPEEAL-RRWREVASANWRATAEVLAHV-RPGsYLLVDLGSTTLDL 159 Methanopyrus ka...
WP_011034428  99 EDKEQGIRFIKENVDSAFGS-GkVSYINSQGRFRKEN----DPLRDLAAANWAASARLIGEE-IGD-CIFVDVGSTTSDI 171 Methanosarcina ...
WP_003604764  75 ADRADGVHQLSAWAAATLKG-S-VRIYAGPAGFVSANNAR-AHAADIASANWHATAALIGRH-VPH-ALLVDIGSTTADL 149 Methylobacteriu...
WP_011447618  58 ASKQDGIEFIFTAVRDVFP--H-AIFYGTDGQFHT------TPVSDLAAANWLVMADVLRDR-YPD-AVLVDMGSTTTDI 126 Methanospirillu...
WP_011405987  76 ESKTEGVLDISKKVMTIFNDkI-VKFVTFDG-LKSYDDIL-ENPLNAAAANWVGTSNAI-KY-IKNnCIFMDMGTTTTDI 150 Methanosphaera ...
WP_010877986 104 KSRAEGVEFIAKACKKAFED---VRFLDVEGNLKSDI----DNPENFAASNWVASCRFLLEEaYRN-FLFVDMGSTTTDI 175 Archaeoglobus f...
WP_010962064  75 EDRMTGVQTLTATMLRRFGPeG-ILVFAGRVGFLRADAVQpRHALDVASANWLASASLIAHR-LREpALFVDIGSTTTDL 152 Methylococcus c...
3C0B_A       142 IPIVEGKVVAE-KTDLERLXNHELLYVGTLRTPISHLGNTISFKGVDTNVSSEYFAITADISVVLEKVTTEEYTCDTPDG 220 Methanococcus m...
WP_011170016 142 IPIVDGKVVAE-KTDLERLMNHELLYVGTLRTPISHLGNTILFKGVNTNVSSEYFAITADISVVLEKVTTEEYTCDTPDG 220 Methanococcus m...
WP_002813371 153 IPCKDSIPCPRgKNDQERLASGELLYSGVTRTPLIALARRAPLEGQWIRLAAEWFATTADVYHLLGRLSPSDDLHPSADN 232 Nitrosococcus o...
WP_010876467 150 IPVKDGFEAARgRNDLERLSTGELVYTGTLRTNVATIVDRVPLQDKWFRVSSELFAVTADVHRVLGNIGESDYTCSTPDG 229 Methanothermoba...
WP_011018485 160 IPIIRGEVAAEgRTDLERMKNGELAYLGALRTPISFLLREVEIDGEPVPVSYEYFSIVADALLLLGEIDPEDYTPETPDG 239 Methanopyrus ka...
WP_011034428 172 IPVISGEHRAg-HTDFERLLRSELVYAGTLRTNLAALLEKVKLEKGICRTSSELFATTADAYLILGEINEDKYTCETADG 250 Methanosarcina ...
WP_003604764 150 IPIVGGQPAAQgYSDAERLETGELVYTGVVRTPLLAFATHAPWRGRRTRLMAETFASTADIYRLTGDLPEGADQQYSADL 229 Methylobacteriu...
WP_011447618 127 IPL-NAWETLKgQTDFTRLKTGMLLYYGLLRTPVSSLIRSVCLDGSPVRVSTEYFACAGDAHVLMGLIPPEMYTTVPPDS 205 Methanospirillu...
WP_011405987 151 IPIINKQNIAK-HTDVERLGSGELVYTGMLRTNIATIVHSIPIYNIDTSVSSELFTITADVHRILGNITQEEYTCNTPDN 229 Methanosphaera ...
WP_010877986 176 IPVTSKIEAAK--TDFERLKRGELIYFGVLRTPVFYVLKE--FEGAP--LCPEFFAITADVFVTTGDIKEEDYSCDTPDG 249 Archaeoglobus f...
WP_010962064 153 VVLGGGEVRARgYTDYDRLRYDELIYTGVVRTSAMALADELPFEGEWVNLMAEHFATTADIYRLTGELAEHTDQMPAADD 232 Methylococcus c...
3C0B_A       221 KGTDKRSSLVRISKVLCSDLDQISEIDAENIAKNYYELWKELILENVENVAEKYGSK---K---VVITGLG-ENILKDAL 293 Methanococcus m...
WP_011170016 221 KGTDKRSSLVRISKVLCSDLDQISEIDAENIAKTYYELWKELILENVKKVAEKYGSK---K---VVITGIG-ENILKDAL 293 Methanococcus m...
WP_002813371 233 RGKQPRDCARRLARMVGTDSKHWPLPAWQGLAAYFAEQQCQQLTDAVFQVLSRVDISpkaP---LIGAGIG-RFLVAECA 308 Nitrosococcus o...
WP_010876467 230 AGKSVEECMLRIARVLCADLELLSPGDVLDVAEYIYHQQILKIAEGIAEVSEREGLE---E---VVTTGLGmKILAQRAA 303 Methanothermoba...
WP_011018485 240 RGKSPEECARRLARTVCSDPEELGWEGVMDLAKTAVRALLGQLLKHIELKLQEHGLD---T---VVAAGAG-DFLIEMAC 312 Methanopyrus ka...
WP_011034428 251 VGRSKIEAMRRIARLVCADLSEVGETEVYEIAEQVKEKQVSALTEAISEVAERNRLE---K---IAAAGLG-EFLISEAA 323 Methanosarcina ...
WP_003604764 230 KGKSIPETELRLARMVGRDRGEGSAEEWRALAAWFAEAQLRPLHDATAILLSRSDLP---EdapLVVCGAG-RFLAERLA 305 Methylobacteriu...
WP_011447618 206 CSPSWDHCMRRMARMVCADVAEIGTEYVLHIAQAYVHEEQVCITQAVRSVMEQYACR---R---ILTVGVG-SGLLSs-- 276 Methanospirillu...
WP_011405987 230 KDKDIVSCKRRLSRLVCADLDSLTDETINNMAQYIYKKQVNQVLTGLIKVVEKTGLD---T---VVISDFGhGNICKNAA 303 Methanosphaera ...
WP_010877986 250 KGRSREECMRRLARTVCSDLEELGEEKVKELALEAKWAMIDRLSEVIEHKSKIYGLK---T---VFACGIG-EFLIAEAC 322 Archaeoglobus f...
WP_010962064 233 GEKSIAGSERRLARLVGRDREDGTAEQWRQLALCLRERQLARITRAIERQFSRNTLPaesP---LVGAGAG-RFLARVLA 308 Methylococcus c...
3C0B_A       294 A--DFEVISVAERYGK--------D-VSLATP 314 Methanococcus maripaludis S2
WP_011170016 294 G--DFEVISVAERYGK--------D-VSLATP 314 Methanococcus maripaludis
WP_002813371 309 RrlRRPYADFSEALDI--------H-PPipis 331 Nitrosococcus oceani
WP_010876467 304 EvlELECRTMDEFLTE--------E-ECVVAP 326 Methanothermobacter thermautotrophicus
WP_011018485 313 KriGVEVEPFDEIFGK----------GSEVAP 334 Methanopyrus kandleri
WP_011034428 324 ErlGFECISVAGRWGE--------E-ISKVFP 346 Methanosarcina mazei
WP_003604764 306 ArlGRRRVPLTETIARclngedaaW-VSTCGP 336 Methylobacterium extorquens
WP_011447618 277 ---WLDAHDLNRDMGS----------LSDAMP 295 Methanospirillum hungatei
WP_011405987 304 KqlGLNIINIDEYISK--------E-ATSIIT 326 Methanosphaera stadtmanae
WP_010877986 323 EeaGAECRLISELYG---------D-YSKLFP 344 Archaeoglobus fulgidus
WP_010962064 309 ArsGRPYVDAIDLLPR--------PtVTTALP 332 Methylococcus capsulatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap