1FTR,1M5H


Conserved Protein Domain Family
one_C_fhcD

?
TIGR03119: one_C_fhcD 
Click on image for an interactive view with Cn3D
formylmethanofuran--tetrahydromethanopterin N-formyltransferase
Members of this protein family are the FhcD protein of tetrahydromethanopterin (H4MPT)-dependent C-1 carrier metabolism. In the archaea, FhcD is designated formylmethanofuran--tetrahydromethanopterin N-formyltransferase, while in bacteria it is commonly designated as formyltransferase/hydrolase complex subunit D. FhcD is essential for one-carbon metabolism in at least three groups of prokaryotes: methanogenic archaea, sulfate-reducing archaea, and methylotrophic bacteria. [Central intermediary metabolism, One-carbon metabolism]
Statistics
?
PSSM-Id: 132163
View PSSM: TIGR03119
Aligned: 9 rows
Threshold Bit Score: 468.031
Threshold Setting Gi: 499484913
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FTR_A         8 IEDTFAEAFEAKMARVLITAASHKWAMIAVKEATGFGTSVIMCPAEAGIDCgYVPPEETPDGRPGVTIMIGHNDEDELKE 87  Methanopyrus ka...
WP_010962053   8 IDETFAEAFPMRATRVIVTAQNLKWAHHAAQAMTGFATSVIACGCEAGIER-ELDPAETPDGRPGVSALLFAMGGKGLAK 86  Methylococcus c...
WP_007327946  18 IKDTFAEAFDMKATRLIVTADDRRWCDESARAMCGFGTSVIACGLEIAVEQ-TLSPEQTPDGRPGVAILAFGMSGKDLEK 96  Rhodopirellula ...
WP_011407070   6 IEDTYAEAFNTKAAHLLITAATKNLAFTAATEATGFATSFIGCPAEAGIDK-YISPDKTPDNRPGYSIIICQNKIKQVEQ 84  Methanosphaera ...
WP_029600726   8 VIDTFAEAFGMSAARVVVTAESARWAVEAARAATGYAASVIGCDAEAGLEK-ELTPAETPDGRPGVSLLFFAFSRDALQK 86  Gemmata obscuri...
WP_010879696   8 VEETFAEAFDIKIARVLITGYDYYWAWVAANEATGFGTSVIMCPAEAGIEI-KAKPSETPDGRPGYYIQICHMSKKGLEE 86  Archaeoglobus f...
WP_003597588  11 VEDTFAEAFDVAGTAIIVTNDTPKWAMIAATVMTGFATSVIGCGAEAGIDA-ELSPDETPDGRPGVRILLFGFEPNGLKD 89  Methylobacteriu...
WP_011171553   8 IEDTFAEGFPIWVSRVLITAATERLAKAAATEATGFACSVIMCPAEAGIEK-YVSPAETPDGRPGYIIEICHPKKAEIEH 86  Methanococcus m...
1M5H_A         8 VEETFAEAFDIKIARVLITGYDYYWAWVAANEATGFGTSVIMCPAEAGIEI-KAKPSETPDGRPGYYIQICHMSKKGLEE 86  Archaeoglobus f...
1FTR_A        88 QLLDRIGQCVMTAPTASAFDAMPEAe---kEdEDRVGYKLSFFGDGYQEEDEL-----DG-----R----KVWKIPVVEG 150 Methanopyrus ka...
WP_010962053  87 QLETRAGQCVLTSPTSALFAGIVEG-----E-QIPLGKNLRYFGDGFQISKRI-----GG-----K----RYWRIPVMDG 146 Methylococcus c...
WP_007327946  97 QIPRRAGQCVLTCPTTALYGGIPGGrevhpK-RVPIGKSLRYFGDGNQISKQIqhldaDG-----RsrpvRYWRIPVMDG 170 Rhodopirellula ...
WP_011407070  85 QLLERIGQCVLTTATTSVFNLLPDCd----N-NTNLGFKLAFFADGYQEKVEK-----YG-----K----TLYKIPIMSG 145 Methanosphaera ...
WP_029600726  87 ALVNRVAQCILTCPTTACFNGLPIDp---tR-SIRIGGNLRFFGDGWQISKLL-----DG-----K----RYWRVPVMDG 148 Gemmata obscuri...
WP_010879696  87 QLLARLGQCVLTAPTTAVFNGLPDAe----E-KFDTGFKLKFFADGYEKEVEV-----GG-----R----KCWAVPMMEG 147 Archaeoglobus f...
WP_003597588  90 QLLKRVGQCILTCPGTACFAGVEGP-----T-KIKLGGAIRYFGDGFAVAKRL-----PDhegkmR----RYWRIPVMDG 154 Methylobacteriu...
WP_011171553  87 QLLERIGQCVLTAPTTAVFNAMGEDa---tE-ELKVGFKLKYFGDGYEKKVKCe---eCD-----K----TLYSIPIMGG 150 Methanococcus m...
1M5H_A        87 QLLARLGQCVLTAPTTAVFNGLPDAe----E-KDDTGFKLKFFADGYQKEVEV-----GG-----R----KCWAVPMMEG 147 Archaeoglobus f...
1FTR_A       151 EFIVEDSFGITTG-VAGGNFYIMAESQPAGLQAAEAAVDAIKGVEGAYAPFPGGIVASASKVG---S-KqYDFLPASTND 225 Methanopyrus ka...
WP_010962053 147 EFLCQETTGMIKA-VGGGNFLILAESQPQALAACEAAIEAMRRIPNVIMPFPGGVVRSGSKVG---S-K-YKTLPASTND 220 Methylococcus c...
WP_007327946 171 EFVCQHDVGRVDA-IGGGNFILVGRTMQSVTIASRAAIDAMRELPGIITPFPGGTTRSGSKVG---S-K-YAALFASTND 244 Rhodopirellula ...
WP_011407070 146 DFLIEEDFGITNA-VAGGNLFIMAKTQQSALVAAEAAVNAIKEISGVICPFPGGIVASGSKVG---SkK-YKFMNATTNE 220 Methanosphaera ...
WP_029600726 149 EFLCEDVFGTAKG-VAGGNILIVANTQASGLKAAEDAVDAARAVPGVILPFPGGVVRSGSKVG---S-K-YKKLRASTND 222 Gemmata obscuri...
WP_010879696 148 DFIIENDIGYTNG-IAGGNFFIMAETQPSALAAAKAAVDAISDVEGVITPFPGGIVASGSKVGa--N-K-YKFLKASTNE 222 Archaeoglobus f...
WP_003597588 155 EFLCEDSVRAVDGaVGGGNLLFLGRKHADTLIVAEIAVEAAKAIPGAILPFPGGIVRSGSKVG---G-R-TKGMMASTND 229 Methylobacteriu...
WP_011171553 151 DFLIESKLGIKKG-VAGGNFFIMAENNMAALMAAEAAVDAISEVEKTITPFTGGIVASGSKVGytnP-K-YSFMAATTNE 227 Methanococcus m...
1M5H_A       148 DFIIENDIGYTNG-IAGGNFFIMAETQPSALAAAKAAVDAISDVEGVITPFPGGIVASGSKVGa--N-K-YKFLKASTNE 222 Archaeoglobus f...
1FTR_A       226 AYCPTVEDN----ELPEGVKCVYEIVINGLNEEAVKEAMRVGIEAACQQ---PGVVKISAGNFGGKLGQYEIHLHDL 295 Methanopyrus kandleri
WP_010962053 221 AFCPTLKGQtr-tELSPEIESVMEIVIDGLSDADIAKAMRAGIEAACGLgaaNGIRRISAGNYGGKLGPFLFHLREI 296 Methylococcus caps...
WP_007327946 245 SFCPTLREVtp-sELPSEANAAIEVVIDGLSFDEIAESMRVGITAACEAgasEGLLSVSAGNYGGKLGRHHFKLHEL 320 Rhodopirellula bal...
WP_011407070 221 GYCPTLKDRisdsKLPEDAEGVYEIVFDGLTEESISKATQVAIKAIKTI---PGVIKISAGNYGGNLGKYKINLIE- 293 Methanosphaera sta...
WP_029600726 223 AYCPSLRGAvk-sELPDGVNAVYELVIDGLDLAAVERATWEAMLAATRV---PGVKRITAGNYGGKLGPFHIRLRAL 295 Gemmata obscuriglobus
WP_010879696 223 KFAPSIRDQvegtQIPEGVKAVYEIVINGLNADAIKEATRVGILAATKI---PGVVKITAGNYGGKLGKHIINLNEL 296 Archaeoglobus fulg...
WP_003597588 230 AYCPTLKGRag-sALPPECGVVLEIVIDALTSAAVAESMRAALHAATEIgaqHGLVAVTAGNYGGNLGRHHYHLRDL 305 Methylobacterium e...
WP_011171553 228 KMCPTLKDTvegtEIPADVNGVYEIVIDGIDEASVAAAMKAGIKAAVTI---PGVKKITAGNYGGKLGPYQIKLQEL 301 Methanococcus mari...
1M5H_A       223 KFAPSIRDQvegtQIPAGVKAVYEIVINGLNADAIKEATRVGILAATKI---PGVVKITAGNYGGKLGKHIINLNEL 296 Archaeoglobus fulg...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap