Conserved Protein Domain Family

TIGR03118: PEPCTERM_chp_1 
TIGR03118 family protein
This model describes and uncharacterized conserved hypothetical protein. Members are found with the C-terminal putative exosortase interaction domain, PEP-CTERM, in Nitrosospira multiformis, Rhodoferax ferrireducens, Solibacter usitatus Ellin6076, and Acidobacteria bacterium Ellin345. It is found without the PEP-CTERM domain in several other species, including Burkholderia ambifaria, Gloeobacter violaceus PCC 7421, and three copies in the Acanthamoeba polyphaga mimivirus. [Hypothetical proteins, Conserved]
PSSM-Id: 132162
Aligned: 4 rows
Threshold Bit Score: 492.093
Threshold Setting Gi: 499782237
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_011140340 467 LWGLTFGNGESLGRANYLYFAAGPNDEQDGLFGSLNA 503 Gloeobacter violaceus
WP_011380729 316 LWSISPGNDTLAGSSHLLYFTAGPDDEAHGLVGVLTP 352 Nitrosospira multiformis
WP_011462971 314 LWALAPGNGVAGGSTQSLYFTAGPDGETHGLFGVLTA 350 Albidiferax ferrireducens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap