Conserved Protein Domain Family
cas5_csf3

?
TIGR03116: cas5_csf3 
CRISPR type IV/AFERR-associated protein Csf3
Members of this family show up near CRISPR repeats in Acidithiobacillus ferrooxidans ATCC 23270, Azoarcus sp. EbN1, and Rhodoferax ferrireducens DSM 15236. In the latter two species, the CRISPR/cas locus is found on a plasmid. This family is one of several characteristic of a type of CRISPR-associated (cas) gene cluster we designate Aferr after A. ferrooxidans, where it is both chromosomal and the only type of cas gene cluster found. The gene is designated csf3 (CRISPR/cas Subtype as in A. ferrooxidans protein 3), as it lies third closest to the repeats.
Statistics
?
PSSM-Id: 132160
View PSSM: TIGR03116
Aligned: 3 rows
Threshold Bit Score: 333.468
Threshold Setting Gi: 499777969
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011254652   4 PLKITFHLDTPM-QRSGYPIHLDALVAYAQTHAALagMDADNAPTGMLRELAE---DlpLAKTENNDEWVWKASALIPVS 79  Aromatoleum aro...
WP_012606751   3 PLEIRFRLATPMlVHSDLPFHFDALMAYAVSRDSE--MNGSADPWLDAEDLSE---I--LGREGEGDSWVWQASRMEVLA 75  Acidithiobacill...
WP_011458703   3 PLRIEFKLVGPW-SPPAYGVHFDGLIAHAVVRDAL--RTASVSALGEERQYDHlicDlpFEKYESKAGWCWKASKLQVIG 79  Albidiferax fer...
WP_011254652  80 FGEKSVRMWTRKTNPYDIARRIIaDKVEIGVRteNALKAGKPYAGAIDTARGLLKNMHEFYPVEEIHQLDAWCIGDIDLL 159 Aromatoleum aro...
WP_012606751  76 RLPYPKIYESANNLRFTDPSRFY-DDLDRGLW--QPRGKVNPETFRIDPNSGQQRGYQMYLTTSNAQEVAFYVIGEEEAI 152 Acidithiobacill...
WP_011458703  80 FHGQQRRYLTAKT-PVNDMARAIgDGIV------EAKGGS-----IIDTVRGIGKNAALYYTLEHAEELHAWCIGDKEAL 147 Albidiferax fer...
WP_011254652 160 ENLLAPesgwITHIGKRTRIGHGRVKTIQ------IEEDEEALEKWKLRVLP--WPEAG---YEPIQAGLRPPYW 223 Aromatoleum aromaticum
WP_012606751 153 RFYLSQ----VTHLGKGSKNGYGRISNAE------IRDCPEAADRWRKRWLHkdMPGADgveYAPVMGRLRQPYW 217 Acidithiobacillus fe...
WP_011458703 148 ESLLLE----IDGIGVKTRLGHGALAPFEdgrlfrVVADESATTRWKNRNAPdkLEDTM---YPGI-GSTHSPYW 214 Albidiferax ferrired...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap