Conserved Protein Domain Family

TIGR03112: 6_pyr_pter_rel 
6-pyruvoyl tetrahydropterin synthase-related domain
Members of this family are small proteins, or small domains of larger proteins, that occur in certain Firmicutes in the same regions as members of families TIGR03110 and TIGR03111. Members of TIGR03110 resemble exosortase, a proposed protein sorting transpeptidase (see TIGR02602). TIGR03111 represents a small clade among the group 2 glycosyltransferases. Members of the current protein family resemble eukaryotic known and prokaryotic predicted 6-pyruvoyl tetrahydropterin synthases.
PSSM-Id: 132156
Aligned: 7 rows
Threshold Bit Score: 137.886
Threshold Setting Gi: 489644349
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_003700266   87 DYFFDEINLQLHEINCYLHQLEIGESPTRFYVVN 120  Lactobacillus salivarius
WP_010965866   85 KFFKDNMKALLAEKGWILLSIEISETPTRSYVID 118  Clostridium acetobutylicum
WP_010965875   85 VYFKETLGKLLSKNGWVLLSIEISETPTRSYIID 118  Clostridium acetobutylicum
WP_010965820   84 KVLIPYIKDIISKKEMKFISMEISENPTRTYVIE 117  Clostridium acetobutylicum
WP_010965871   85 NFLFKEITKVFNEKKVELTRLEISENPSRVYVVN 118  Clostridium acetobutylicum
WP_010965882   85 DFFFDELKDRLKLKGIFLNKLEISETPARVYVVN 118  Clostridium acetobutylicum
WP_003548789   86 EYLATEISKELKIIKSKLHRIEVSEDPIRTVCLE 119  Lactobacillus acidophilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap