Conserved Protein Domain Family
glyc2_xrt_Gpos1

?
TIGR03111: glyc2_xrt_Gpos1 
putative glycosyltransferase, exosortase G-associated
Members of this protein family are probable glycosyltransferases of family 2, whose genes are near those for the exosortase homolog XrtG (TIGR03110), which is restricted to Gram-positive bacteria. Other genes in the conserved gene neighborhood include a 6-pyruvoyl tetrahydropterin synthase homolog (TIGR03112) and an uncharacterized intergral membrane protein (TIGR03766).
Statistics
?
PSSM-Id: 132155
View PSSM: TIGR03111
Aligned: 5 rows
Threshold Bit Score: 693.409
Threshold Setting Gi: 499268424
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010965879   6 GKTYREMVFWMAWIIIPFLMEIVPALGGFIILLRKRLSIKDKAFSGKLPQITIIVPVYNSEDTLKGCIESIYNSDYPSEF 85  Clostridium ace...
WP_010965868   6 SKTLRELIFWMAWIIIPLIMEIIPAFGGFFILVKKSFNSNREGFIGTLPEITLIIPIYNSEATLKGCIESIYNCSYPTRL 85  Clostridium ace...
WP_003548791   4 ANLIIQLGFWISWLLVPIIYEFIPAVVGFFSLLMAKRHLKNIKPLKEYPYITLIIPVYNSADTLFNCIKSIKDSSYPEHL 83  Lactobacillus a...
WP_011101666   5 NLALTRMGFWITWALVPIVVEIIPAIMSTIKLMRLHRHMPRLKAPAKWPWVTIIVPVYNSEDTLFDCIRSIDHQTYDKKS 84  Lactobacillus p...
WP_010965817   3 QQLIIQLLFWGIWLVIPLIVDIIGGVIGAIFITVSYFRKKKLD-IGYLPDITILIPIYNSENTLENCLNSVINQTYPIEK 81  Clostridium ace...
WP_010965879  86 IDVMLVDNQSSDNSFKIFTRCQKEFDGLSLRYMNSKQGKSKALNMALFNSSGKYIIHIDSDGKLHKDAIKNMVTRFEGNP 165 Clostridium ace...
WP_010965868  86 IDLILVNNMSSDDSFQVFSQCQKEFCGLSMRYMNSKQGKSKALNMALFNSAGKYIIHIDSDGKLHYDAIKNMIVRFEKNP 165 Clostridium ace...
WP_003548791  84 IKIIIADNQSTDESYQVYLHARNIFPDLYMNWINTDQGKAKALNAAIYKSIGKYVIHIDSDGILQHDALKNMVTDFENDP 163 Lactobacillus a...
WP_011101666  85 MQIILANNQSTDDSFGAYARAQNAFPNLFLRYVNTDKGKARALNAAIYESIGSYVINIDSDGLLEPNAIKNMVLRFENDE 164 Lactobacillus p...
WP_010965817  82 ISVMLINNGKRDKAYNVFCSFQERNPRLKVWWLDSSSGKAKALNKGIYMANGKYIINIDSDGVLDKEAILKVVEKFETNP 161 Clostridium ace...
WP_010965879 166 HVHCMTGVILTDKELIEKTKGSFFKLLRKCEFFEYAQAFLAGRNFESEVGSIYTLSGAFSAFRKSTILKTQLYNSETVSE 245 Clostridium ace...
WP_010965868 166 NIHCMTGAILSDIEGIEKTHKRFLKLIRRCEFFEYAQAFLAGRNFESEINSIYTLSGAFSAFRKSTILKTQLYNSKTVCE 245 Clostridium ace...
WP_003548791 164 SIDALTGTILTRKDLIKKTKNRFLKFVRENEYLEYSQSFLAGRAVESQDNHLFTMSGAFSAFRRDKLLHTNLYNIETVGE 243 Lactobacillus a...
WP_011101666 165 QIAAMTGAVLPQRNLVKQVHGWWHRLLAKNEYYEYAQAFLSGRTIESFRDQLFTMSGAFSAFRREVLMETFLYDTDTIGE 244 Lactobacillus p...
WP_010965817 162 DICAMTGVVLTDPELIEETKLKNLRLIQRCELFEYIEAFLIGRGFQSQVNMMFTLAGAFSCYRREIIMKTQLYNNETLGE 241 Clostridium ace...
WP_010965879 246 DTQITFQVKKLLNQKVYLCENALFFVDPIEGFNKLYTQRQRWQRGELEVSHMFLRDGLKFGKGFVSDFMVRTLMYDHTFA 325 Clostridium ace...
WP_010965868 246 DTHITFQVRRLLKKKVYLCENSIFFVDPIENLNKLYTQRQRWQRGEIEVSHMFFKNKMNSPLGFFHNFMIRVVMYDHTFA 325 Clostridium ace...
WP_003548791 244 DIDMTFQIRYQLHGKVILCPQAIFYVYPLDNLNKLYTQRQRWQRGELETLHMFFESRSIGISNIFSNFIVRRLIMDHTIL 323 Lactobacillus a...
WP_011101666 245 DTDMTFQIRTRLGKKVVICADAIFYVAPISGFSELYTQRQRWQRGELEVAQHYM-SQTASIKGFFKEFLVRRIMIDHTFT 323 Lactobacillus p...
WP_010965817 242 DTHMTSQIRELLDGKIALCEEAFFYVDPIDDLDKLYIQRQRWQRGQMEVSALFNEIANKNTKRFINVLKV-TIIKDHSLV 320 Clostridium ace...
WP_010965879 326 FPRMIWYFALIFLVFMNYPIYLVVGSVAVIYLLYSLSAFLFYLNVISYLKKYKEVRSYYAKKFYLIFLMPMYNFGVFWIR 405 Clostridium ace...
WP_010965868 326 FPRMIWYFAIIFLFFMNYPVKLVVGSLVIIYMLYVLSTFLFYLNVRIYLKEYKSIREYYKARWGYIFLMPIYNFVVFWIR 405 Clostridium ace...
WP_003548791 324 LLRVIWMFAYLFLIPLGYSVKVIGLSFVLLYFLYILISALNFINIQSFLKNFKSDRRYYLSKFYIIFSLPIYYFVCSFIQ 403 Lactobacillus a...
WP_011101666 324 FPRMIWTFATIVLIAFGYSTVVVGLSYLLIYSLYVMVGVINFISVGILLKPYPEERHFYKHLWWLTLTLPLYMFLTAWIR 403 Lactobacillus p...
WP_010965817 321 FPRFIWIFAMMYLVFLDYPLTLVVGANLILYIVYVITSTIYFFIAKLFLKEKKQIKDYVNKHWYIILLLPIYRFVVFFIR 400 Clostridium ace...
WP_010965879 406 FCGIINSIQLQGNWKTLNLTDEWRNFLGVFKRDFSVVFK 444 Clostridium acetobutylicum
WP_010965868 406 FAGIINSIKIKSKWKTLTLNDEWTAFLKVIQSDFRMIGK 444 Clostridium acetobutylicum
WP_003548791 404 VIGIINAMTTPAEWTTRNMTGEVKAFNNIVKRDFTRIFH 442 Lactobacillus acidophilus
WP_011101666 404 LIGVINAMTTQATWKMRGFTEEWQRLLAVLRDDRRTIHN 442 Lactobacillus plantarum
WP_010965817 401 VAGIINAVEKNASWNTKTFSQEREIVDVRLKKNLSLYYR 439 Clostridium acetobutylicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap