Conserved Protein Domain Family
eps_aminotran_1

?
TIGR03108: eps_aminotran_1 
exosortase A system-associated amidotransferase 1
The predicted protein-sorting transpeptidase that we call exosortase (see TIGR02602) has distinct subclasses that associated with different types of exopolysaccharide production loci. This model represents a distinct clade among a set of amidotransferases largely annotated (not necessarily accurately) as glutatime-hydrolyzing asparagine synthases. Members of this clade are essentially restricted to the characteristic exopolysaccharide (EPS) regions that contain the exosortase 1 genome (xrtA), in genomes that also have numbers of PEP-CTERM domain (TIGR02595) proteins.
Statistics
?
PSSM-Id: 132152
View PSSM: TIGR03108
Aligned: 7 rows
Threshold Bit Score: 1083.61
Threshold Setting Gi: 500031566
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011310805   1 MCGITGIFDTSGVNAISRDLLQRMNETQHHRGPDEGGLHLEPGLGLGHRRLSIIDLSSGQQPLANEDGSVVVVFNGEIYN 80  Thiobacillus de...
WP_002811447   1 MCGITGIFDLHERRPIDREILSRMNDIQRHRGPDGGGIHVEPGIGLAHRRLSIIDLSLGRQPLSNEDGTVWVTYNGEIYN 80  Nitrosococcus o...
WP_011112343   1 MCGITGVFDTRSTSEIDRNLLHRMNETLTHRGPDEGEVYVESGLGLGHRRLSIMDVSSGQQPLFNEDGSVVVVFNGEIYN 80  Nitrosomonas eu...
WP_011238224   1 MCGIAGLFDLRGKRDFSRDLVRRMNDVQVHRGPDEGGYHFEPGIALAHRRLSIIDLSTGQQPLFNEDGSVAVVFNGEIYN 80  Aromatoleum aro...
WP_011390869   1 MCGLVGIYHPTASRPVDRALVEAMNQRQFHRGPDDGGVFIGPGIGLGHRRLSIVDLGGGRQPMTNDGGGVVLVYNGELYN 80  Rhodospirillum ...
WP_011445970   1 MCGIAGIVHTEGPKPVDPDRVRRMCDAIAHRGPDGEGVWTAPGIGLGHRRLSIIDLAGSPQPMKAAEGDAVIVFNGEIYN 80  Novosphingobium...
WP_011712284   1 MCGLSAILDLTGQRLPEAEQLTAMTRALAHRGPDGEGMHREPGVGLGHRRLSIIDLAGGAQPLWNEDRSVAVVFNGEIYN 80  Magnetococcus m...
WP_011310805  81 FQELVPELEALGHVFRTHSDTEVIVHAWEAWGEACVARFRGMFAFVLWDRNQETLFVVRDRFGVKPLYYAFLDTGEFIFG 160 Thiobacillus de...
WP_002811447  81 FKELMAELSHRGHVFRTQCDTEVIVHAWEEWGEKCVHHFRGMFAFAIWDRKQETLFLARDRLGIKPLYYALLPNGQLIFG 160 Nitrosococcus o...
WP_011112343  81 FQKLVGELTALGHRFRTHCDTEVIVHAWEEWGERCVERFSGMFAFGVWDRNRQTLFMARDRLGIKPFYYTLLDNGLFLFA 160 Nitrosomonas eu...
WP_011238224  81 FQELVPELEALGHAFHTRSDTEVIVHAWEAWGEDCVQRFRGMFAFALWDRNRETLFLARDRLAVKPLFYALLPDGTFAFG 160 Aromatoleum aro...
WP_011390869  81 NAELVAELKAAGHVFRTASDTETVIHAWEEWGEDSVRHLRGMFAYALWDDRSQTLFLARDRLGIKPLHYTCLADGRVMFG 160 Rhodospirillum ...
WP_011445970  81 FRDLRKELQALGAQFRTDGDTEVILQAWRQWGTACLPRLHGMFAFALYDLRQRTTLLARDRLGVKPLFTARLADGAVIFG 160 Novosphingobium...
WP_011712284  81 FPDLMQRLQGLGHQFHSRSDTEVIVHAWEQWGEQCVEALQGMFAFALWDRCQGVLFVARDRLGIKPLYYGFSEDGWLLVG 160 Magnetococcus m...
WP_011310805 161 SELKSLMVHPSLGREVDPLAVEDYFAYGYVPEPRTIFKRVHKLPPGFTLTLKRGAPRALPKQYWDMPFA-PVAVKDEAGA 239 Thiobacillus de...
WP_002811447 161 SELKALITHPHLPRQLDSLAVEDYFAFGYIPDPRTIFRYANKLAPGHTLTLRCGASKLEPRQYWDVTLE-PQALGSESAI 239 Nitrosococcus o...
WP_011112343 161 SELKALLVHPDFDKTFDHRAIEDYFAYGYIPEPKTIFKNAFKLNPGHLLSLQRGQQTVQSREYWDIPFT-PHGSLSEEEA 239 Nitrosomonas eu...
WP_011238224 161 SELKVLMQHPLLDRRIDAHAVEEYFALGYVAEPRTIFAGAKKLGAAETLCVRRGQPVPQPRCYWDVHFM-LDNPLSLAEA 239 Aromatoleum aro...
WP_011390869 161 SELKSLTGVEDIPKVVDPLAIEDFLAYGYVPDPRSIFKDILKLEAGHTLTFRRGEAPGRPHCYWDVSFTtPSRPAKTDDL 240 Rhodospirillum ...
WP_011445970 161 SELKALLAHPSLRREIDPLAVEDYLAWGYVPDHRSMLKGVEKLPAGHYQLLRHDAPPAAPVQWWDVSFA-DRANGSAEDL 239 Novosphingobium...
WP_011712284 161 SELKALTAHPGLSRSLDPKGVMDYFAYGYIPDPHSIYRQVKKLEPGYCARFTLGSGDWRLRCYWDLSFA--AQPLTEAAA 238 Magnetococcus m...
WP_011310805 240 MDELVERMKESIRLRMIADVPLGAFLSGGVDSSAVVAMMATQSSTPVNTCSIGFDDPAFNEIEYAQQVADRYHTRHHVET 319 Thiobacillus de...
WP_002811447 240 EETLIEKFREAVNIRLVADVPLGAFLSGGVDSSAVVAAMAQLSNDPVRTCSIGFSDPAFDEARYAEQVAHRYGTNHHSAQ 319 Nitrosococcus o...
WP_011112343 240 AEELILRLRNAVDSHLMSEVPLGAFLSGGVDSSAVVAMMGGLMKEPVNTCSIAFSDPAFDESDYARLVAERYQTRHFTEQ 319 Nitrosomonas eu...
WP_011238224 240 SAELTARLRESVRLRMIAEVPLGAFLSGGVDSSAVVATMAGLSDEPVHTCSIAFDDPAFNESDFAQKVADRYRTNHYVET 319 Aromatoleum aro...
WP_011390869 241 CAEVIDRLDEAVRCHLVADVPVGAFLSGGVDSSAMVALMAGATDRPVETCSIAFSEARFDESAYAKTVAERYGTHHRVHT 320 Rhodospirillum ...
WP_011445970 240 GAHLLHHMRDAVTSRMVADVPLGAFLSGGVDSSSVVALMAEASATPVKTCSIGFDVAALDETAYADRIAARFATEHRKRL 319 Novosphingobium...
WP_011712284 239 LQQLQELLGQTVQSHTLADVPLGAFLSGGVDSSLITALLAKQSQTPLQALTVAFTGSREDEAPHARAVAQHLGVQQQLLT 318 Magnetococcus m...
WP_011310805 320 VAADDFSLVGKLAQVYDEPYADSSALPTYRVCELARKHVKVALSGDGGDEHFAGYRRYRWFRYEERMRSIIPLGLRRPLF 399 Thiobacillus de...
WP_002811447 320 VDQDDFELINRLAGVYDEPYADSSAMPTYRVCELARQRVKVVLSGDGGDELFAGYRRYRWHLHEQRVRGILPLSMRQPLF 399 Nitrosococcus o...
WP_011112343 320 VQQDDFDLIDRLAALYDEPFADSSAIPTYRVCELARKRVTVALSGDGGDENFAGYRRYRWHMIEERLRSKLPLGLRKPLF 399 Nitrosomonas eu...
WP_011238224 320 VKSDDFDLIDTLAGLYDEPYADSSAIPTWRVCQLARKRVTVALSGDGGDESFGGYRRYRLHLMEERMRGALPLGVRQPMF 399 Aromatoleum aro...
WP_011390869 321 LPAQALSEVGPLTAIYDEPFADSSALPTLKVCQAARETVTVALSGDGGDELFAGYRRYRFHTAEEAVRRILPQAARGPLF 400 Rhodospirillum ...
WP_011445970 320 VSPDDFSLVDRLAGMFDEPFADASALPTFRVCELAREHVTVALSGDGADEAFAGYRRQTFQHREEQARALLPSALRKPLF 399 Novosphingobium...
WP_011712284 319 VDPLDFERLERLPGLYDEPFADSSAWPTFLLCEAAASRMKVVLSGDGGDELCAGYSRYRLFMAEQQVRQRVPSWLRRGLF 398 Magnetococcus m...
WP_011310805 400 GTLGLLYPKADWAPKMFRAKTTFEALARDTVEGYFHGVSLLSNAQRAQLFSPAFRRELQGYQAVDVLRRHAAVAPtDDPL 479 Thiobacillus de...
WP_002811447 400 GILGHYYPKLDWAPRIFRAKTTFQALARDPLEGYFHSVAVIPNELRHRLFSQRMRQELQGYEASQVLRNHARQAP-DHPL 478 Nitrosococcus o...
WP_011112343 400 GLLGSVYPKADWAPKFLRAKTTFESLARDSVEGYFHSVSILDNKLRMQLFTRDFYRDLQGYRAVEVLRDYADKSPtKDAL 479 Nitrosomonas eu...
WP_011238224 400 GLLGRLYPKADWAPRMFRAKTTFQALARDSLQAYFHSVSILRDAMRRQLFSNRFRSELAGYNAIEVFRRHAATAHtDDAL 479 Aromatoleum aro...
WP_011390869 401 GALGRVYPKLDWAPQVLRAKSTFQALGRDRVEGYFNAVSVIPDGLRRGLYSKTMRAELAGYGASEVLRRHMTRAPaDHPL 480 Rhodospirillum ...
WP_011445970 400 GTLGRLWPKADWAPRPLRAKTTLLSLAASGEEGYARALSVTSPELRETLYTPDFKRLRGDYRAEQPLIELMRKAPaRSGL 479 Novosphingobium...
WP_011712284 399 GPMGMLYPKLDNAPRWLRAKSTLQALGEGPLEGLFRGASMMDPAMGQGLLAPDLM--LLDYHPIEHFYRLNARLPeQVAF 476 Magnetococcus m...
WP_011310805 480 -SLVQYLDMKTYLVGDILTKVDRASMAHALEVREPLLDHELMGWVSGLPVDLKLRGSEGKYLLKKAMEPYLPHDVLYRKK 558 Thiobacillus de...
WP_002811447 479 -LQVQYLDLKTYLPGDILTKVDRASMAHGLEVRVPLLDHPFVEWAGGLSPHFKYRSREGKYVFKRALRPYLSDEILYRRK 557 Nitrosococcus o...
WP_011112343 480 -SLIQYLDMKTYLVGDILTKVDRASMAHSLEVRVPLLDHELVEWVSGLPASMKLRQQEGKYILKRSLEPYLPNEVLYRNK 558 Nitrosomonas eu...
WP_011238224 480 -ALIQYVDLKTYLVGDINTKVDRASMAHSLEVREPLMDHKLVEWLATLPSGLKVKGQEGKYLFKKAMEPLLPNDVLYRPK 558 Aromatoleum aro...
WP_011390869 481 -SIAQYVDLKTWLPGDILTKVDRASMATSLEVRVPMLDHRFVEWTAGLSPDLKLSGGTGKYLLKRALRPLLPDEVLYRRK 559 Rhodospirillum ...
WP_011445970 480 -DRAQYADLKFYLPGDILTKVDRTSMAVGLEAREPLLDHRLVEFGASLPERLRVRGATGKWLIKQTMRRYLPEDVLFRPK 558 Novosphingobium...
WP_011712284 477 hDRMLYLDFKTFLAGRVLTKVDRASMAVGLEVRVPLLDHRLVEWAGRLPWCLKMQGGQGKYLLKKLAAQQVPATAVYRSK 556 Magnetococcus m...
WP_011310805 559 MGFSVPLAAWFRGPLAATIRTVVLGERLAGTGMFNCEFLREVVEAHQSGRRDFSVILWTVLMFDAFLGQV 628 Thiobacillus denitrificans
WP_002811447 558 MGFAVPLAAWFRGPLRERVRTAVTGQILAETGLFEMPILRHLVDQHLSGLRDYSASIWSLLMFDAFLRQA 627 Nitrosococcus oceani
WP_011112343 559 MGFSVPLASWFRGPLRERVRTALLGNTLAGTGIFDMGFIKKMLDQHQSGRRDYSAPIWTLLMFEAFLRNI 628 Nitrosomonas europaea
WP_011238224 559 MGFSVPLSRWFRGPLRERVRQTVLGETLAATGIFNPDYLRHLVDAHQSGARDYSSPLWSLMMFEAFVRSS 628 Aromatoleum aromaticum
WP_011390869 560 MGFSIPLTDWLRGPWSGRTRALAGRSALVTSGLFDGAAVAKLVEQHLGGNWDHGAALYALIVLDDFLTAH 629 Rhodospirillum rubrum
WP_011445970 559 MGFVTPLAQWLRGPLAHEARALASDGLLARTGWLDAARIDALADAHVSGRADHSRLIWQLLMLRKSLQLL 628 Novosphingobium aromatici...
WP_011712284 557 QGFIPPLAAWLRGPLQERLQDRLSSRVITESGLFHPRWIHWMLEQHRKKKQDLSMPLWSLLMFEGMLRKA 626 Magnetococcus marinus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap