Conserved Protein Domain Family
glu_aminopep

?
TIGR03107: glu_aminopep 
glutamyl aminopeptidase
This model represents the M42.001 clade within MEROPS family M42. M42 includes glutamyl aminopeptidase as in the present model, deblocking aminopeptidases as from Pyrococcus horikoshii and related species, and endo-1,4-beta-glucanase (cellulase M) as from Clostridium thermocellum. The current family includes [Protein fate, Degradation of proteins, peptides, and glycopeptides]
Statistics
?
PSSM-Id: 132151
View PSSM: TIGR03107
Aligned: 6 rows
Threshold Bit Score: 628.381
Threshold Setting Gi: 23024264
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q48677         4 FDKVKALTEIQATSGFEGPVRDYLKARMVELGYQPEFDGLGGIFVTKASKVENAPRIMVAAHMDEVGFMVSSIKADGTFR 83  Lactococcus lac...
ZP_00784677    5 FNKIKTVTELDGIAGYEHNIRNFLRQEITPLVDQVETDGLGGIFGVKNTHETNAPKVMVAAHMDEVGFMVSHIQPDGTFR 84  Streptococcus a...
ZP_00875871    4 FEKIKEVTELQSLPGFEGQVRNHIRQKITPHVDRIETDGLGGIFGIKDTTVENAPRILVAAHMDEVGFMVSQIKPDGTFR 83  Streptococcus s...
ZP_00063482    6 WARVKKYTELQGTSGQEHAIRQSFRSDLEPLVDTIHQEGLGGVYGVKEGQ---GPRVMFAAHMDEVGFIVKDILPSGALK 82  Leuconostoc mes...
WP_011226615   5 FNKIKEVTELKAAAGFETPVRDYLRKTITPLVDEVQTDGLGGIFGIKHSQTENAPKVLVAAHMDEVGFMIKEIKADGTFR 84  Streptococcus t...
WP_010709935   6 FQRIKELTELQGTSGFEDDIRAYMKEHITPLVDDVQYDGLGGIFGIKRSKVEAAPRVMVAAHMDEVGFMLTQINDNGLFQ 85  Enterococcus fa...
Q48677        84 VVPLGGWNPLVVSGQRFTLFTRTGKKIPVVTGGLPPHLLRGTGVTPQIPAISDIIFDGAFENAAEAAEFGIAQGDLIIPE 163 Lactococcus lac...
ZP_00784677   85 VLEVGGWNPLVVSSQRFTLYTRSGDAIPVISGSVPPHFLRGQSGGTTLPKISDIVFDGGFTDKNEAESFGIAPGDIIVPK 164 Streptococcus a...
ZP_00875871   84 VVELGGWNPLVVSSQAFTLQLQDGRTIPAISGSIPPHLTRG-GNAPGVPAIADIIFDAGFTNYDEAWAFGVRPGDVLIPK 162 Streptococcus s...
ZP_00063482   83 VAALGGWNPAVISSQRFTLFTSKGK-YPIVSSSVSPHLLRGSAHGPQMPTVEDILFDGGFLDKDEAWSFGVRPGDFIVPQ 161 Leuconostoc mes...
WP_011226615  85 VVELGGWNPLVVSSQRFTLHTRDGRIYPVISGSVPPHFLRGSSGTSSLPGVSDVVFDAGFANQEEANTYGVFPGDVIIPE 164 Streptococcus t...
WP_010709935  86 VVPLGGWNPYVVSAQRFTLKTSKGN-YPCISSSIPPHLLRGTSGQKQL-EVSDVLFDAGFSSKEEAESFGVRPGDSIVPQ 163 Enterococcus fa...
Q48677       164 TETILSANGKNIISKAWDNRYGCLMILELLEFLADKELPVTLIIGANVQEEVGLRGAKVSTTKFNPDLFFAVDCSPASDT 243 Lactococcus lac...
ZP_00784677  165 SETILTANQKHIMSKAWDNRYGVLMVTELLKSLKDQSLSNTLIAGANVQEEVGLRGAHVSTTKFNPDIFLAVDCSPAGDI 244 Streptococcus a...
ZP_00875871  163 NETILTANGKNVISKAWDNRFGVLMVTELLESLSGQALPNQLIAGANVQEEVGLRGAHASTTKFNPDIFLAVDCSPAGDI 242 Streptococcus s...
ZP_00063482  162 VSTVMTANKRRVISKSWDNRFGLVTILDALEELENVQTPNTLIMGANVQEEVGLRGSHGAVNLLKPDIFFAVDSSAADDT 241 Leuconostoc mes...
WP_011226615 165 SETILTANQKNVISKAWDNRYGVLMIRELLENVKDQELNNTLIAGANVQEEVGLRGAHVSTTKFDPEVFFAVDCSPAGDI 244 Streptococcus t...
WP_010709935 164 TETIKTANGKNIISKSWDNRYGCTLVLDALETLQNEELGHTLIAGANVQEEVGLRGSKPSVHKFNPDIFFAVDCSAADDI 243 Enterococcus fa...
Q48677       244 FGDDn--GRLGEGTTLRFFDPGHIMLPGMKNFLLDTANHAKVKTQVYMAKGGTDAGAAHLANGGVPSTTIGVVARYIHSH 321 Lactococcus lac...
ZP_00784677  245 YGEQ---GKIGEGTLIRFYDPGHIMLKDMRDFLLTTAEEAGIKYQYYAAKGGTDAGAAHLKNSGIPSTTIGVCARYIHSH 321 Streptococcus a...
ZP_00875871  243 YGDQ---GKIGDGTLLRFYDPGHIMLKNMKDFLLTTAEEAGVKFQYYCGKGGTDAGAAHLKNHGVPSTTIGVCARYIHSH 319 Streptococcus s...
ZP_00063482  242 SGQNghqGILDQGTLLRVFDPTVVMPLRLKEFLLSVAEDNHIPYQYFVSKGGTDAAAAQTELTGVPAVALGVASRYIHTH 321 Leuconostoc mes...
WP_011226615 245 YGNQ---GKVGDGTLIRFFDPGHIMLPNMKDFLLTTAEEAGIKYQYYCAAGGTDAGAAHLQNSGVPSTTIGVCARYIHSH 321 Streptococcus t...
WP_010709935 244 HTKKgtyGHLGEGTLLRIFDPGLITLPRLREYLLDTAATHNIPYQYFVSKGGTDAGAAHTTNNGVPSTVIGVCGRYIHTH 323 Enterococcus fa...
Q48677       322 QTIFNIDDFLQAQTFLRAIITSLNTEKVAEIK 353 Lactococcus lactis subsp. cremoris MG1363
ZP_00784677  322 QTLYAMDDFLQAQAYLQAIVNKLDRSTVDIIK 353 Streptococcus agalactiae COH1
ZP_00875871  320 QTLYSMDDFLEAQAFLQAIVKKLDRSTVDLIK 351 Streptococcus suis 89/1591
ZP_00063482  322 QTVWSIKDFEASKAFVVAIAKNLDDANLKTIM 353 Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
WP_011226615 322 QTLYAMDDFLEAQAFLQAIVKKLDRSTVDLIK 353 Streptococcus thermophilus
WP_010709935 324 QTMFSIADYEAAREMLLQALRGLDKSTVNTIV 355 Enterococcus faecalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap