Conserved Protein Domain Family
trio_M42_hydro

?
TIGR03106: trio_M42_hydro 
hydrolase, peptidase M42 family
This model describes a subfamily of MEROPS peptidase family M42, a glutamyl aminopeptidase family that also includes the cellulase CelM from Clostridium thermocellum and deblocking aminopeptidases that can remove acylated amino acids. Members of this family occur in a three gene cassette with an amidotransferase (TIGR03104)in the asparagine synthase (glutamine-hydrolyzing) family, and a probable acetyltransferase (TIGR03103) in the GNAT family.
Statistics
?
PSSM-Id: 132150
View PSSM: TIGR03106
Aligned: 7 rows
Threshold Bit Score: 587.865
Threshold Setting Gi: 518562003
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_019732210  11 DRTWMVDTLLALLQTPSPSGRTDAVMQVIGDILDDFGVPFTLTRRGALTAELPGESATTDRALVVHSDTIGCMVRGLKDN 90  Mycobacterium a...
WP_011395583  10 DSEYLTKVLLELLAIPCPTGFTDGAVVYVCERLSDLGIDYELTRRGTIKGRLQGKLNAPQRAVVTHLDTIGAMVREIKPN 89  Hahella chejuensis
WP_010975326   8 DPEYLTSRLKALLDIASPTGFTDEAVRYTARELERLGLEVKLTRRGAIRALRPGAAERPARGIVSHLDTLGAQVKALKEN 87  Sinorhizobium m...
WP_011711920  13 NTDYLLETLLTLLTIPSPSGMTDKVVRWVCHELTQLGVEYELTHRGAIRATLPGKDEKRVRGVVAHLDTLGAMVRELKGN 92  Magnetococcus m...
WP_011389740   7 DTDYLARTLVRLLATPSPTGYTDTVVRETCAELESLGLTPTLTRRGAVCVVLRGREARPARAIVSHLDTLGAQVKQLKDN 86  Rhodospirillum ...
WP_011238798  12 DYDYLEETMLQLLAIPSPVGLTDAVVRYTAARLEALGIEYELTRRGAIRATLRGREAQPARAVVTHLDTLGAMVREIKPN 91  Aromatoleum aro...
WP_019437322   9 DLDYLKRVLLEMLAIPSPTGFTDTIVRYVAERLDELGIPFELTRRGTIRATLKGRQATPDRAVSAHLDTIGASVRQLQDN 88  Pseudomonas putida
WP_019732210  91 GRLELVPVGTFSARFAAGARVRIFiDDPEEFiTGTILPLKSSGHAFGDEIDTQPTGWEHVEVRIDRKVSCRDDLVRLGLQ 170 Mycobacterium a...
WP_011395583  90 GRLCLTPVGHWSSRFAEGSRVTIF-SDSGCF-RGSVLPLYAAGHRYNEEVDRLPVTWDHVEIRVDECIYSKEDAFRIGIS 167 Hahella chejuensis
WP_010975326  88 GRLELVSIGHWSARFAEGARASIF-SGKGTY-RGSILPLKASGHTFNEEVDTQPTGWRHIELRVDALARDRNDLVQLGID 165 Sinorhizobium m...
WP_011711920  93 GRLSVSPIGHWNGRFAEGARVTLM-AESGRHmRGTLLPLKASGHVYNEAIDSQPAGWDYVELRLDERAQCVADLMKLGVH 171 Magnetococcus m...
WP_011389740  87 GRLELVPIGTWSARFAEGARVTVF-TDRGAV-RGTILPLKASGHIFNEEIDSLPIGWPMTELRVDARVHSKADLIALGIE 164 Rhodospirillum ...
WP_011238798  92 GRLAIAPIGHWSARFAEGSRVTVF-TDHRQL-RGTCLPLKTSGHAFGSEIDSQPVGWDHVEVRVDVPATTALELEQAGLH 169 Aromatoleum aro...
WP_019437322  89 GRLALAPVGCWSSRFAEGSRVSVF-TDTGVF-RGSVLPLMASGHAFNTAIDQMPISWDHVEVRLDAYCATRADCEALGVS 166 Pseudomonas putida
WP_019732210 171 IGDFVALITSPELTADGFVVSRHLDGKAGVAIALALAKNFAENKVVLPHRTTIMVTITEEVGHGASHGLPPDVAELISVD 250 Mycobacterium a...
WP_011395583 168 VGDFVAFDPNPEFLPNGFVVSRHLDNKAGTAALLTGLKAIVEHDLPLAMDCLPIFTLTEEIGSGVGHAIEADVTEFVGID 247 Hahella chejuensis
WP_010975326 166 VGDIVAIDPQPELLENGFIVSRHLDDKAGVAIMLAALEAMQREKVDTPVDTHWLFTIGEEVGVGASAAIVPEIASLVAID 245 Sinorhizobium m...
WP_011711920 172 VGDYVAVDSAPEVSASGFVNARHLDDKAGVAAMLAAVRTIMAQDITLPAPVYVMFTISEEVGVGASHILHGDISELVSVD 251 Magnetococcus m...
WP_011389740 165 VGDIVAIDPQPEFLANGYIVSRHLDDKAGVALMLAALKALTAHNEPPPVDVHFIFTIAEEVGVGASSALTDDVASVVAVD 244 Rhodospirillum ...
WP_011238798 170 VGDWIAFDPQTEVLPGGYINSRYLDDKAAVAALLAACKAIGDHRLPLAVDVHPLFTITEEVGSGASAALHGEIAEMVSLD 249 Aromatoleum aro...
WP_019437322 167 IGDFVAFDPLPEFTESGHISARHLDDKAGVAALLAALKAVVESGRQPLIDCHPLFTITEETGSGAAGALPWDVSEFVGID 246 Pseudomonas putida
WP_019732210 251 NAVCAPGQHSLEDGVTIPMADMHGPFDYHLTRKLCRLAQDRGIPFARDIFRYYRSDAAAAIEAGANTRAALVGFGLDGSH 330 Mycobacterium a...
WP_011395583 248 IGPVAEGQNAKEHGVTIAMKDSSGPFDWHLTRHLIHLCQDHHIPHQRDVFRYYYSDAVSAVQAGHDIRHALVTFGTDATH 327 Hahella chejuensis
WP_010975326 246 NGTTAPGQNSDEFGVTLAMADQTGPFDYHLSKKLYELCGEHGIRVQKDVFRYYRSDAASAVEAGHDVRTALVTFGVDASH 325 Sinorhizobium m...
WP_011711920 252 NGTLAPGQNTCEFGVTIAMKDSSGPFDYHLTHHLLDLCKEHAIMHSRDVFRYYRSDAAAALEAGNDIRTALVCFGLDASH 331 Magnetococcus m...
WP_011389740 245 NGTSGPGQNSAEFGVTIAMADQTGPFDYHLTRALIRLCRDEDIIFRKDVFRYYRSDAASAVVAGHDVRNALVTFGIDASH 324 Rhodospirillum ...
WP_011238798 250 ISIAAPGQNTSEHAATICVQDMSGPFDYHLTHKLIALAREHGIPHRRDVFRFYRSDSAAAVEAGNDIRTALIGFGGDASH 329 Aromatoleum aro...
WP_019437322 247 IAPVAPGQASSEHAVSVAMQDSSGPYDYHLSRHLLKLAGDHDLPVRRDLFRYYFSDAHSAVTAGHDIRTALVAFGCDATH 326 Pseudomonas putida
WP_019732210 331 GWERTHIDSLEAAYNLLHAWLQTPL 355 Mycobacterium avium
WP_011395583 328 GYERTHIDALTAISDLVVRYAQSEP 352 Hahella chejuensis
WP_010975326 326 GYERIHLHALMSVAKLAVYHAASEV 350 Sinorhizobium meliloti
WP_011711920 332 GYERIHMDSLHALAALLFYYMNHQL 356 Magnetococcus marinus
WP_011389740 325 GYERIHMHALRSVAELLSAYALSPV 349 Rhodospirillum rubrum
WP_011238798 330 AQERTHRDALVALTQLVVAYMTSEP 354 Aromatoleum aromaticum
WP_019437322 327 GYERTHIDSLAALSRLLSAYLLSPP 351 Pseudomonas putida
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap