Conserved Protein Domain Family
trio_acet_GNAT

?
TIGR03103: trio_acet_GNAT 
GNAT-family acetyltransferase TIGR03103
Members of this protein family belong to the GNAT family of acetyltransferases. Each is part of a conserved three-gene cassette sparsely distributed across at least twenty different species known so far, including alpha, beta, and gamma Proteobacteria, Mycobacterium, and Prosthecochloris, which is a member of the Chlorobi. The other two members of the cassette are a probable protease and an asparagine synthetase family protein.
Statistics
?
PSSM-Id: 132147
View PSSM: TIGR03103
Aligned: 7 rows
Threshold Bit Score: 935.692
Threshold Setting Gi: 489974630
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_003877812  31 MAKDVELELGWGRLIFGQTFANSQELVEALRREGPGRRDICIYARESHVVVAEAPTELFIDPSHTYRLRFTGKeKSLAPT 110 Mycobacterium a...
WP_011711917  32 MLDEAVIDCGWGKLVFGQTFSDNQALCQAMRAEQPGQRNVALYLRDPHVVLSLYPQELFLDPSHTYRLALTQDpWQDFTP 111 Magnetococcus m...
WP_010975342  46 AKRDVVLDCGWGRLLFAQTFSDDEKLLSELREEAPSSRDIAFYVRDPHVLLSRAPQEIFLDPSHTYRLDLWTY-RANTRR 124 Sinorhizobium m...
WP_011395582  36 APSSVSVHCGWGRLLLANTFESPKELAKSLAEESTGDRDIALYVADPHVVLSHAPQSLFLDPSDTMRLWMSQY-RPRTRA 114 Hahella chejuensis
WP_011389741   8 FKKEASIDCGWGRLVFGQTFDGPGRLAEVMRTEGPERRDVAIYVRDPHVVLAMAPHEMFLDPSHTYRLDLARY-RPSARQ 86  Rhodospirillum ...
WP_003252632  35 HDQPRAVHCGWGRLLIGHTYPDPASLAEDLLDEHPGERDIALYVAAPQQVLAQAPQQLFLDPSDTLRLWFTDY-RPAQRV 113 Pseudomonas putida
WP_011238797  29 MPDNVVIECGWGRLLPGQTWREPALLATELLQERAGQRDIAFYVEKPHVVVAAAPQQLFVDPSEAFRLSLGGY-RSARQT 107 Aromatoleum aro...
WP_003877812 111 PLGVTVRTLNDPIDADAMNRVYVRCGMVPAGVDVIWeNHQHVPAVKYLLAVRDEDGAVVGTVTGVDHELLFNDPEHGSSL 190 Mycobacterium a...
WP_011711917 112 PAALSILPIRGEQDMAVVRQLYETRRMVPPRAGFRL-DGQEGCAPLFLIAIDEQSEQIVGVVNGVDHRCAFNDPENGSSL 190 Magnetococcus m...
WP_010975342 125 TRGITIRRLASEADGDGVNRVYAACGMVQIRSDFFS-SERDDRSLTYFVAQDDATGEIVGTVTGIDHQRLFDDPDRGASL 203 Sinorhizobium m...
WP_011395582 115 LPGVTVRRASSTVDVEALNAIFTQRKMVCAPVEHVL-AHRHSKDIVYLVAEALGSGKIIGTVMGVNHIKAFGDPSKGSSL 193 Hahella chejuensis
WP_011389741  87 PHGFTIRPLAGPGDVDDINRIYAARHMVAVRPDFFE-GPLASRGITLLVAEEGAGGRIIGTVMAIDHGRAFGDPARGSSF 165 Rhodospirillum ...
WP_003252632 114 FRGFRVRRAQNPADWQAINTLYQARGMLPVDAE-LL-TPRHLGGPVYWLAEDEDSGAIIGSVMGLNHTKAFDDPEHGSSL 191 Pseudomonas putida
WP_011238797 108 RRGFTLRRLRTRADVAAINVLYRSRGMVPVDTQRVW-RERASRAITYAMAEDRTSGEIIGVAMGLDHVEAFADAQHGASL 186 Aromatoleum aro...
WP_003877812 191 WTLAVDPAAGLPGVGGALTRALAEHFRSAGCAYMDLSVAHDNAAAISLYEKLGFRRVPVLAIKRKNAINEPLFSPPPETV 270 Mycobacterium a...
WP_011711917 191 WALAVDRKTAIGGVGEALVRALAHHFWQQGRGYMDLSVMHDNEQAIALYNKLGFKQIPVYCLKNKNPINERLFSGPAPEA 270 Magnetococcus m...
WP_010975342 204 WCLAVHPQARQPGIGEHLVRKLAEHFQARGLSYVDLSVMHDNTLAIGLYEKLNFRRMPLFAIKRKNAINEKFFAMPHQSY 283 Sinorhizobium m...
WP_011395582 194 WCLAVSPDSKTPGVGEALVRYLAEYFQTRECQYMDLSVLHDNYEAKALYEKLGFQAIRTFALKKKNAINEKLFVGPEPSA 273 Hahella chejuensis
WP_011389741 166 WCLAVDPQAIHPGIGEALVRAAVEQLAGAGATHTDLTVMHDNDQAIALYDKLGFERVDFFTMKRKNPINERLFTGPAPEA 245 Rhodospirillum ...
WP_003252632 192 WCLAVDPHCTRPGVGEVLVRHLIEHFMSRGLAYLDLSVLHDNRQAKRLYQKLGFRNLPTFAVKRKNGINEQLFLGPGPQA 271 Pseudomonas putida
WP_011238797 187 WALAVAPQAAHPGVGESLVRYLAEHYQARGRISLDVSVMHDNCQAIALYEKLGFQRIPAFAVKRRNAINEPLFTGPEDGA 266 Aromatoleum aro...
WP_003877812 271 -DdLNPYARIIADEALRRGIWVEVLDAETGEMRLTHGGRSVITRESLSEYTSAVAMCRCDDKRLTRRLVSEAGITVPRAR 349 Mycobacterium a...
WP_011711917 271 -N-LSIYSRIIVDEARRRGISVEVLDQSLELFRLKLGGRTVLCRESLSSLTSATAMTVCDNKRLTSRLLKSAGLQVPEQM 348 Magnetococcus m...
WP_010975342 284 -DaLNPYARLIVDEATRRGIHVEITDAEGGFFRLSHGGRSIHCRESLSELTSGVAMSICDDKAITRRMVSAAGLVVPDQI 362 Sinorhizobium m...
WP_011395582 274 -K-LNPYAKIIVNEAMRRGIEVVIDDEVNNLFTLSFGGRRIRCHESLTDMTTALSMSLCQNKMLTHRSCARAGLRTPIYQ 351 Hahella chejuensis
WP_011389741 246 -R-LNPYAEIIVTEARRRGIDVRVTDAEGGFFRLSFGGRSVHCRESLSELTSGVAVSICDDKAVTRRLVEAAGICVPEQI 323 Rhodospirillum ...
WP_003252632 272 -D-LNPYARIIVDEALRRGIEVQVDDAAGGLFTLSLGGRRIRCRESLSDLTSAVTMTLCQDKRLTQHALHNAGLQVPAQQ 349 Pseudomonas putida
WP_011238797 267 qD-LNPYARLIVTEARRRGVLVEVLDAENGYFRLTLGGRSIVCRESLSELTSAIAMSRCQDKRVTLKLLREAGLRVPAQA 345 Aromatoleum aro...
WP_003877812 350 LAT-FDEGDFAFLKEVGEVVVKPTRGEQGKGITVGVTAengPDDLSAALARARAQYP--DVLIEQRVPGDDLRLVVIDGR 426 Mycobacterium a...
WP_011711917 349 VVG-KGERVENFLARHGAVVVKPVRGEQGRGISVDVRD---LTSLEQAIAKAQQEGDgeQVLLERLVVGDDLRIIVIGHE 424 Magnetococcus m...
WP_010975342 363 EVDeNGKAIQDFLKKHGKLVVKPARGEQGRGISVGITT---MEALEEAIASARQVCD--RVLLEAFFEGEDLRLVIIDYT 437 Sinorhizobium m...
WP_011395582 352 LYR-SREQAEEFLADHGAVVVKPLDSEQGKGISVDVRN---VDDLHAAISKAESVSS--SVLLETYHPGFDLRVVVIDFD 425 Hahella chejuensis
WP_011389741 324 EAG-DGAAVRAFLAHHGSVVVKPARGEQGRGIAVGLDT---AEAVDAAIVTAGRFCE--RVLVERCAAGEDLRLIIIDFH 397 Rhodospirillum ...
WP_003252632 350 LAG-NADDNLAFLEEHGAVVVKPVDGEQGQGVAVNLTC---IDDITRAVAHARQFDS--RVLLESFHAGFDLRIVVIGYE 423 Pseudomonas putida
WP_011238797 346 DAT-DAEANERFLAEHGAVVVKPVEGEQGKGISVDLRS---PDDVAAAIGRAHHFCD--RVILEQYCEGEDLRIVVIDFR 419 Aromatoleum aro...
WP_003877812 427 VVAAALRLPPEVIGTGEHSVRDLIAAESRRRSAATGGESRIPLDELTEATVAEAGWKLDDVLPQGTRLRVRRTANLHQGG 506 Mycobacterium a...
WP_011711917 425 VVAAAVRKPPMIRGDGHSNIAALIQRQSRRRAAATEGESRIPLDGETQRCVQEAGLEMHSILDKGQQLLVRRAANLHTGG 504 Magnetococcus m...
WP_010975342 438 LVAAAVRLPPRVIGDGRSKIASLIGKQSRRREAATGGESRIPLDAETDRCLAEQGLDLETILEEGREITVRKAANLHAGG 517 Sinorhizobium m...
WP_011395582 426 TVAAAIRRPAEIYGNGRDSIRTLVEKQSRRRAAATGGESQIPIDAETERCIREAGYDWDSVLPVEAHLFVRRTANLHTGG 505 Hahella chejuensis
WP_011389741 398 LVAAALRRPPRVTGDAKTTLRDLIAVQSRRRAAATGGESSIPLDDETVRCLAASGFTLEDVPVEGCDIVVRRTANLHTGG 477 Rhodospirillum ...
WP_003252632 424 VVAAAIRHPAQVLGDGKHSVRQLIEAQSRRRQAATGGESRIPLDDETERTLRAAGVGYDDVLPAGQRLAVRRTANLHTGG 503 Pseudomonas putida
WP_011238797 420 VVAAAVRRPPVVVGDGRSTVLELIEKQSRRRQAATGGESSIPVDEETERCLRMQGHGLEDVLDHDVQIRVRNTANLHTGG 499 Aromatoleum aro...
WP_003877812 507 TIHDVTAQVNSELCRVAVTAAEAIGIPVTGIDLLVPDVTGADYAFIEANERPGLANHEPQPTAAAFIDFLFPGHPGQ 583 Mycobacterium avium
WP_011711917 505 TIHDVTEQLHPALREAAEQASMVLDMPLVGLDFLVPDVQGPDYVIIEANERPGLANHEPQPTAKRFIDMLFPQTTLP 581 Magnetococcus marinus
WP_010975342 518 SIHDVTEIVHPDLVEAACRAARAINIPVVGIDLMVRDPAEPDYVFIEANERPGLANHEPQPTAASFIELLFPGSRTA 594 Sinorhizobium meli...
WP_011395582 506 TLIDVTDDLHPELRAAAEEAARALQIPVVGMDFIVKDHTSPDYVIIEANERPGLENHAPQPTAQRFIDLLFPLTRSV 582 Hahella chejuensis
WP_011389741 478 TIHDVTDEVHPDLVAAGIRAARAIDIPVVGIDLLVRSPRAPDYVFIEANERPGLANHQPQPTAERFIDLLFPNSVPA 554 Rhodospirillum rubrum
WP_003252632 504 TLEDVTERLHPVLADAAVRAARALEIPVVGLDFMVRDAGQPEYVIIEANERAGLANHEPQPTAERFIDLLFPHSRPL 580 Pseudomonas putida
WP_011238797 500 TIHDVTGELHPDLRDAAEAAARALDIPVTGLDFLVPAVDRGDYVIIEANERPGLANHEPQPTAERFIDLLFPRTRAA 576 Aromatoleum aromat...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap