Conserved Protein Domain Family
hydr1_PEP

?
TIGR03100: hydr1_PEP 
exosortase A system-associated hydrolase 1
This group of proteins are members of the alpha/beta hydrolase superfamily. These proteins are generally found in genomes containing the exosortase/PEP-CTERM protein expoert system, specifically the type 1 variant of this system described by the Genome Property GenProp0652. When found in this context they are invariably present in the vicinity of a second, relatively unrelated enzyme (ortholog 2, TIGR03101) of the same superfamily.
Statistics
?
PSSM-Id: 132144
View PSSM: TIGR03100
Aligned: 5 rows
Threshold Bit Score: 317.91
Threshold Setting Gi: 499765251
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011288164   4 TERAFTFSCSGEALLAILAEPEASG-QTGVLIVVGGPQYRVGSHRQFVLLSRALADAGFPVLRFDSRGMGDSTGVFGGFE 82  Dechloromonas a...
WP_011330814  38 AEEALTFHCLGELLVGILHRGSEYA-TRGVLVVVGGPQYRVGSHRQFVLFARWLAEAGVPVFRFDYRGMGDSGGGTRTFE 116 Nitrosococcus o...
WP_011238246   4 REIPLVFSCGSEPLIGVLHIPNRPA-RLGVIVIVGGPQYRVGSHRQFLLLARELASGGFACLRFDYRGMGDSASNLCTFE 82  Aromatoleum aro...
WP_011390872  10 AEEALSLTCEGSSLIGVFHPTAKPHpTVGLIIVVGGPQYRVGAHRQNVRLARHVAEAGFPVLRFDLRGMGDSEGTAPGFE 89  Rhodospirillum ...
WP_011445985   2 TRRHLTFACEGATLVGTLDIDGASH-GTGLLIVSGGNELRAGAWSGQAQLATRLAHAGFPVFRYDRRGVGDSEGENLSFR 80  Novosphingobium...
WP_011288164  83 QIDEDIAAAIDAFFENCPQVERIVVWGLCDAASASLLYwdATHDERVCGLVLLNPW----VRSEATLAKTHIKHYYGQRL 158 Dechloromonas a...
WP_011330814 117 NIEVDIRAAIDAFLEAAPGLREIVIWGLCDAASAACFY--APSDPRVAGLVLLNPW----VRTEEGQAAVYLKHYYFRRL 190 Nitrosococcus o...
WP_011238246  83 DVDADIHAAIDALLEACPELEGVVLWGLCDGASAALMY--APLDARVKGIVALNPW----VRTDASLATARLNHHYKRQI 156 Aromatoleum aro...
WP_011390872  90 ASRADITAALAGLRAWVPSLRQIVAWGLCDGASAVLLD---LDHVPLAGAILVNPW-----AQEAEQAPLRDRLYYRGQL 161 Rhodospirillum ...
WP_011445985  81 GALPDIAAALAAFRSAAPHLSRIVAFGNCDAAAALMLF--G-AELQVDGLVLANPWtidgEEAPDAMPASAIRSRYLGKL 157 Novosphingobium...
WP_011288164 159 LQA-DFWRKMLTGKLGFSSSLKGFISSV---LNARQQGKKV--VDGKklpFQEKMARGLERFSGPALFVLSGNDFTAKEF 232 Dechloromonas a...
WP_011330814 191 VSG-DFWRKFWRREFDYKDSLRSLGDILrkaNSWRQKVDEV--ETEEilpLPKRVYKALEQFQGRTLLILSGKDLTANEF 267 Nitrosococcus o...
WP_011238246 157 LSA-HFWRRLLSGEVRLARSLLGLADAIr--KAARQKGRAAnrAPQS---FLERMNAGCQRMQGKVLFVLSGNDLTAREF 230 Aromatoleum aro...
WP_011390872 162 RSK-AFWGKLLRGDLPWRSALRGLGG-L---LKRAPRGDET--AQGG---LACRLRAALARHKVPLLVILADQDVTAGLF 231 Rhodospirillum ...
WP_011445985 158 ASPrEIWR-LLSGGVNLGKLARGLRTA---------AGHSP--AHAG---LAQDMKAGLDAFAGPVAILLASRDRTAQMF 222 Novosphingobium...
WP_011288164 233 LGALKTEPLWNAIQQRSHVEMVHVDDADHTFSSAVWRNAVATGVTDWLQR 282 Dechloromonas aromatica
WP_011330814 268 RDTISSSSAWRGLLRSRSIERRELSTADHTFSRRVWRDQVAQWTLEWVRS 317 Nitrosococcus oceani
WP_011238246 231 ADFCHARPEWRRALE-PGLNFVEIEGADHTFSTRKWKRSVEGATLNWVRN 279 Aromatoleum aromaticum
WP_011390872 232 AASVLGSRRW------PGITVTSLPGADHTFSDPRHEQRLREITTQWLKA 275 Rhodospirillum rubrum
WP_011445985 223 ------EEAWGG--EDPRIAR--IDSASHSFSDEAAREWLHARLVEALTR 262 Novosphingobium aromaticivorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap