Conserved Protein Domain Family
dCO2ase_PEP1

?
TIGR03099: dCO2ase_PEP1 
pyridoxal-dependent decarboxylase, exosortase A system-associated
The sequences in this family contain the pyridoxal binding domain (pfam02784) and C-terminal sheet domain (pfam00278) of a family of Pyridoxal-dependent decarboxylases. Characterized enzymes in this family decarboxylate substrates such as ornithine, diaminopimelate and arginine. The genes of the family modeled here, with the exception of those observed in certain Burkholderia species, are all found in the context of exopolysaccharide biosynthesis loci containing the exosortase/PEP-CTERM protein sorting system. More specifically, these are characteristic of the type 1 exosortase system represented by the Genome Property GenProp0652. The substrate of these enzymes may be a precursor of the carrier or linker which is hypothesized to release the PEP-CTERM protein from the exosortase enzyme. These enzymes are apparently most closely related to the diaminopimelate decarboxylase modeled by TIGR01048 which may suggest a similarity (or identity) of substrate.
Statistics
?
PSSM-Id: 132143
View PSSM: TIGR03099
Aligned: 6 rows
Threshold Bit Score: 580.16
Threshold Setting Gi: 499710149
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011145126  20 FVIKDDCLEIGGIPLTRLETQIGQTPFFAYSRKHIDQQVCLLRKYLPEKISIHYAIKANPFVPLIHHLSQKIEGFDVASA 99  Photorhabdus lu...
WP_011330812  13 FPIKNDCLLVGGVPLTEFAARVGSTPFYAYERRLISERIQHLRTHLPSEIYIHYALKANPMPALAGHIAPLVDGLDVASL 92  Nitrosococcus o...
WP_011238242  19 FSVAKGELVVGGISLTRLAARVGRTPFYAYDRGLLTQRVSELRTALPREVRLHYAMKANPMPALVCHMAKLVDGIDVASA 98  Aromatoleum aro...
WP_004512931   3 LTEQNGKTCLRNICFEELAARYG-TPFYLYDLDKVKEKCAAVRKAFGDSLELLYAVKANPNRELLAAMRGEVDGLDIASA 81  Geobacter metal...
WP_011445980  11 YETIDGELAVDGHKVTDLVMQAGGTPLFVYSRALLTRRVQDLRAAMPERLAIHYAVKANPYIPLLSHMLELVDGFDIASG 90  Novosphingobium...
WP_011390883   9 FGVSGSDLTIGGQRVSHLARIAGGTPFYAYDRGAVSARIAALRAALPAGMAIRYSLKANPMAALLAHMAPLVDGFDAASA 88  Rhodospirillum ...
WP_011145126 100 NEMALALNTGVSPEDISFAGPGKTDTELKRAIAAQV-LLNVESLNELRRIQILSEKLGLCARVSLRINPDYNLNSSGMKM 178 Photorhabdus lu...
WP_011330812  93 GELRVALDTGTPPESISFAGPGKSDAELAASLAAGI-TINMESEGEMERIAHLAEKQGRRPRVAVRVNPNFELKTSGMKM 171 Nitrosococcus o...
WP_011238242  99 GELKVALDAGADPGEISFAGPGKQDAELQQSVAAGI-LVNLESFREIAPLVAASVALGLPARVAVRVNPDFELKSSGMKM 177 Aromatoleum aro...
WP_004512931  82 GELERALETGYDAGCISFAGPGKTRDELRRSLEAGVgCISVESLRELNDLRDLVRAGSHRAYILVRVNPQLLIRDFAVKM 161 Geobacter metal...
WP_011445980  91 GELAIVRDAGIDPAMVSFAGPGKRDAELEAAIAAAV-TLNLESEGEATRALAIAGRLGIVPRLAIRVNPDFDLKGSGMKM 169 Novosphingobium...
WP_011390883  89 GELRAGLAVGMAPAALSIAGPGKSPADILSAVAAGA-LVVVESLAEVGRVAQAGNASGLRPRVLVRVNPEAEIQGAGLRM 167 Rhodospirillum ...
WP_011145126 179 GGGPRQFGMDVVYVPEALMFIRDYpdSLVFEGFQIYPGSQNLCAEHLIEAQNKALNLVIELSHSAPSPVRRFNLGGGFGV 258 Photorhabdus lu...
WP_011330812 172 AGGPKPFGVDAERVPAMLARINTL--DLDFQGFHIFSGSQNLRAEAIIEAQERTFTLALELARSAPTPVRLLNIGGGFGI 249 Nitrosococcus o...
WP_011238242 178 GGGPKQFGVDAEQVPQLLAEIGRA--GLAFEGFHLFAGSQNLKAEAIVEAQRKSFELALRLAEHAPAPVKFLNLGGGFGI 255 Aromatoleum aro...
WP_004512931 162 GGKASQFGIDEEELPSALDFIKANadAFDFKGIHIYAGTQCLNEEALAQNLANTLAIAARITTDYGMECRVINIGGGLGV 241 Geobacter metal...
WP_011445980 170 GGGAKPFGIDAERVPALARKLISA--GAEWRGFHIFAGSQALSADAIIETQAQTIGLAARLAEETGAPLPKCNLGGGFGI 247 Novosphingobium...
WP_011390883 168 GGGARPFGIDADQVPGVLAAIAAH--DLDYQGLHCFWGSQALDAERIARAFAVVGQTLLDLA--GPRPPRQIVIGGGFGI 243 Rhodospirillum ...
WP_011145126 259 PYFQGNTELNITEVGNAMHKLVERAEKFL-PEVEIILELGRYLVASSGIYVTKIVERKISHDMTFLVTDGGMNHHLSASG 337 Photorhabdus lu...
WP_011330812 250 PYFPGNKPLDLRPIADNLAASLPKLQRQI-PEAEVTLELGRYLVGEAGIYVCEIIDRKISRGHVFLITNGGLHHHLAASG 328 Nitrosococcus o...
WP_011238242 256 PYFPGEQRLELAPIGDNLAALVAEAARKL-PQAQLVIELGRYLVGEAGIYVCRVIDKKVSRGHTYLVTDGGLHHHLSASG 334 Aromatoleum aro...
WP_004512931 242 SYYEEHPGLDLDKLALLFRAEFDRYREATgTKPRILLELGRFLVAEAGIYVTRVVSEKLSRGEQFYVLDGGMNHHLSASG 321 Geobacter metal...
WP_011445980 248 PYFPGDEPVDVVAVGAALGDQFAALPDVL-RDTAFCIELGRYLVGEAGIYLATVIDRKESHGEVYLVTDGGLHHQLAASG 326 Novosphingobium...
WP_011390883 244 PYTPTSAPLDLARAGAAVAETAGLLGDHL-PGVSLGLELGRFLVGEAGVYVCAIRESKRSRGNLFLVTDGGLHHNQAATG 322 Rhodospirillum ...
WP_011145126 338 NLGQLIRRNYPAIIGNKIKGEKRETVNIVGPLCTPLDILVHQGDMSVATPGDLVVIFQSGAYGLSASPNNFLSQTNAVEV 417 Photorhabdus lu...
WP_011330812 329 NFGQVIRKNYPVVVGNRIQGSTREIASVVGPLCTPLDLLADRMELAQAEAGDLIVVFQSGAYGRSASPLGFLSHPVPAEV 408 Nitrosococcus o...
WP_011238242 335 NFGQVIRKNYPVAIGNRMGDAATENYSVVGPLCTPLDLLGEKINLPQVQPGDLVVIHQSGAYGASASPTGFLGHPEIIEI 414 Aromatoleum aro...
WP_004512931 322 NLGMTIRKNYLVRNLSR-PGAERIICTLVGPLCTPLDLMGKGVTVEVPEVGDLVGFLNSGSYGYSASPLLFLGHGEPCEL 400 Geobacter metal...
WP_011445980 327 NFGTVVRRNYPSAIATRFGAAVEEEASIVGCLCTPLDRLADKGGFPRTDTGDLVVIFCAGAYGASASPAAFLGQGPAREM 406 Novosphingobium...
WP_011390883 323 NFGQVVRRPYPLVIATRMGEPVSERATITGCLCTPLDVFAEALAIPAAAEGDLVAIFQSGAYGASASPSAFLGHPPAVEL 402 Rhodospirillum ...
WP_011145126 418 LV 419 Photorhabdus luminescens
WP_011330812 409 LV 410 Nitrosococcus oceani
WP_011238242 415 LT 416 Aromatoleum aromaticum
WP_004512931 401 LV 402 Geobacter metallireducens
WP_011445980 407 LV 408 Novosphingobium aromaticivorans
WP_011390883 403 LV 404 Rhodospirillum rubrum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap