Conserved Protein Domain Family
PEP_O_lig_1

?
TIGR03097: PEP_O_lig_1 
probable O-glycosylation ligase, exosortase A-associated
These proteins are members of the O-antigen polymerase (wzy) family described by pfam04932. This group is associated with genomes and ususally genomic contexts containing elements of the exosortase/PEP-CTERM protein export system, specificially the type 1 variety of this system described by the Genome Property, GenProp0652.
Statistics
?
PSSM-Id: 132141
View PSSM: TIGR03097
Aligned: 5 rows
Threshold Bit Score: 532.781
Threshold Setting Gi: 499710108
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011330810   4 RDILITGVIFALLPVCFLRPWIGILVWTWISIMNPHRLTWGFAWDMPFAQLVAIAILGGMLLVRD-RKSIAWTPELRLLL 82  Nitrosococcus o...
WP_011310810   2 RDIFVVSVIFGLLPFVLRRPWLGILLWSWLGYMNPHRLAWGFAYNLPFSMIVGLVTIAAFMASKE-KKEMPWTRETIFLL 80  Thiobacillus de...
WP_011712270   2 RDLILTLFIVGSLPYAFMRPSYGLLMWALLSYMNPHRLTWSYAYDFRFNFLVAFVTLAGVFFNKEvKFRIPIHGTTIFWM 81  Magnetococcus m...
WP_011112537   2 RDLLIVSIVAVMAVMALRRPWVGVMLWTWLSIMNPHRYSWGFAYSAPLAAVAAGVALLGLAFTKE-RQSPFQGAPVAWFA 80  Nitrosomonas eu...
WP_011390842   2 RDLLLALLLVSSLPLIIVRPYVGVFVWCVVSLMNPHQMAYGFISSAPVALLVAGSTLIGLLASRE-PKRLPGDPIVICIL 80  Rhodospirillum ...
WP_011330810  83 VLFGYMTFTTFFAWAPDAAWQQWDKVAKIFLMSYVTTILIYGKQRIYWLLLVATLSLGFYGFKGGLFTILTGGQFHVMGP 162 Nitrosococcus o...
WP_011310810  81 IFVAWMLFTTLFAFYPDVAWMQWDKVWKIQLMIFLTALIINDRDKLHWLLWVIVLSFGFYGIKGGIFTIINGGAYRVQGP 160 Thiobacillus de...
WP_011712270  82 FFCLWTVVTSFNSFDPDRAFSEFDRFLKIQLMVLITFFLIKDRKWMDWLIWVIVLSIGVWVMKGGLFTLTSGGNFRVYGP 161 Magnetococcus m...
WP_011112537  81 LLTIWITLSWLFGYDPAGDYVQWSKVMKIYFMTFVALMLLSNKYHLMAFAWVTVGSLALLGAKGGFFTVLHGGNYRVWGP 160 Nitrosomonas eu...
WP_011390842  81 LLAFWVSVTTVFALRPDVAFPLWDRTIKMFLMVLVGLALIRSRQRLHALVWILVVSIGFYGVRGGLFTLVTGGGGRVVGP 160 Rhodospirillum ...
WP_011330810 163 PKSFLAGNNFLGLAMVMGLPLLLVFAQQEARVWFRRLLYATFALTFIAVPFTYSRGAMLGLAVVSVLLFMRWRNKALLVI 242 Nitrosococcus o...
WP_011310810 161 SETFITGNNELALALVMTIPLIRYLHLQDTRKWMKTGLAAAMVLTGVAAIGSQSRGGLVAMVAMGIFLWLKSRNKIVTGL 240 Thiobacillus de...
WP_011712270 162 ARSFITDNNALALAVLMGLPLTFYIRQFAKRLWQKQLALVLIIFSVITVVGSYSRGGMLGLVVVLGVLFGRSRRGMIVFL 241 Magnetococcus m...
WP_011112537 161 PGSFIADNNHFALALIMTVPLLHFLQLQLQKPWQRHLMTVTMLSCVASALGSHSRGALLAISAMGAVLWWRSNRKGLMSF 240 Nitrosomonas eu...
WP_011390842 161 PTTMIGDNNSLAAALIMTLPLMRYLHLQSANRWIRLGLAGAMGLTALSVLGSFSRGALLASVAMFFWMLVRSRKRLMILA 240 Rhodospirillum ...
WP_011330810 243 MLIPILFGGLAFVPEKLFNRAESI----QNYE--MDASSMQRIAAWDLAWNIAIDRpLRGGGFEYeGDTARWHTYLDpky 316 Nitrosococcus o...
WP_011310810 241 YMAVAVGIIAAVMPQEWYDRMNTI----NTYQ--DDQSAQGRINAWHTAFNVAKDR-VTGGGFEM-WRPPVFRQYAP--- 309 Thiobacillus de...
WP_011712270 242 LGVVLVALSYTSMPKHWQERMDDFfaisTAYElrEDASMMGRLNSWVLAWELAKDRpFVGGGFNT-FTAERFQTYAP--- 317 Magnetococcus m...
WP_011112537 241 GVLVVLLLLLPMMPEEWWARMGTI----QTYE--EDASAMGRINGWLVAIEVAKHY-LFGGGMSY-QHEFFFSMWGV--- 309 Nitrosomonas eu...
WP_011390842 241 LGATFAIGGLFLMPESWHDRMNTI----SDYQ--EDESAMGRLDAWTFAFNLAVERpLVGGGFRInVDRDVFLRFSP--- 311 Rhodospirillum ...
WP_011330810 317 yyVMEGAHVAHSIYFQMLGQHGFVGLSLFMIILFLTYRRLGRLKKWTLEISDLRWIGQYAWALRVGLVGYAVTGAFLNLA 396 Nitrosococcus o...
WP_011310810 310 --DPYNVRDVHSIYFEIMGEQGFIGFALFMLLGLLAWLRAQQIIKRCKKDPDKKWAADLAAMIQVSLIGYAAGGAFLGMG 387 Thiobacillus de...
WP_011712270 318 --VPFERHDAHSIYFEVMAEHGFFGFALFIGMHLFAVLLGFKVKHLARGKPELDWAVTLATMLQISLLGYYVAGVFLGLA 395 Magnetococcus m...
WP_011112537 310 --YNTNVIAAHSIYFQILGNHGFIGLALYLGLWASTLWQAGWLRRHARSIPEAKWTVDLGSMVQVSLIGFAVGGAFLSMP 387 Nitrosomonas eu...
WP_011390842 312 --EAGINRAFHSIYFQVLGEHGFVGLGLFLATLALGFFKAGALSRQCAGDPKLAWARDLGAMSQVSLVGYAAGGAFLDLA 389 Rhodospirillum ...
WP_011330810 397 YFDLYYLFVVLAALL 411 Nitrosococcus oceani
WP_011310810 388 YFDLPYHLMVILVLV 402 Thiobacillus denitrificans
WP_011712270 396 YFDLPYHLISILVML 410 Magnetococcus marinus
WP_011112537 388 YFDLPYNLMVLVVLA 402 Nitrosomonas europaea
WP_011390842 390 FFDLFYFVALLPVMA 404 Rhodospirillum rubrum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap