Conserved Protein Domain Family
nitroso_cyanin

?
TIGR03096: nitroso_cyanin 
nitrosocyanin
Nitrosocyanin, as described from the obligate chemolithoautotroph Nitrosomonas europaea, is a red copper protein of unknown function with sequence similarity to a number of blue copper redox proteins. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 132140
View PSSM: TIGR03096
Aligned: 3 rows
Threshold Bit Score: 258.379
Threshold Setting Gi: 488897650
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_002808750   2 KITKAIFISFALGLLLMGTAQAKDvkaQSFTVVINAYDTNIPKLEVEGVTVKDIRAFNVLNEPEALVVRKGTPVEITVEN 81  Nitrosococcus o...
WP_011380929   3 KINKAMFAGLAFGMLLTGAVHAAE---QKFTVVINAYDTTIPELNVEGVTVKNIRAFNVLNEPEALTVKKGNTVKVTIEN 79  Nitrosospira mu...
WP_011110790   2 KTTKAMLAGFAVGSLLLAGAAQAE---HNFNVVINAYDTTIPELNVEGVTVKNIRAFNVLNEPETLVVKKGDAVKVVVEN 78  Nitrosomonas eu...
WP_002808750  82 KSPISEGFSIDAYGISEVIKAGETKTIKFKADKAGAFTIWCQLHPMNIHLPGSLNVVE 139 Nitrosococcus oceani
WP_011380929  80 KSPISEGFSIDAYGIKEVIKAGETKTVSFKADKVGAFTIWCQLHPKNIHLPGSLNVID 137 Nitrosospira multiformis
WP_011110790  79 KSPISEGFSIDAFGVQEVIKAGETKTISFTADKAGAFTIWCQLHPKNIHLPGTLNVVE 136 Nitrosomonas europaea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap