Conserved Protein Domain Family
SASP_sspI

?
TIGR03092: SASP_sspI 
small, acid-soluble spore protein I
This protein family is restricted to a subset of endospore-forming bacteria such as Bacillus subtilis, all of which are in the Firmicutes (low-GC Gram-positive) lineage. It is a minor SASP (small, acid-soluble spore protein) designated SspI. The gene in Bacillus subtilis previously was designated ysfA. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 132136
View PSSM: TIGR03092
Aligned: 5 rows
Threshold Bit Score: 94.864
Threshold Setting Gi: 499334878
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EXJ18236      4 NLRGAVLANVSGNTQDQLQETIVDAIQSGEEKMLPGLGVLFEVIWKNADENEKHEMLETLEQGLK 68  Bacillus anthracis str. 95014
WP_011232186  4 NLREAIMHNVANNTKEQLEHTIEDAIQRGEEKYLPGLGVLFEAIWTHANEQQKDMMLTTLEQAVK 68  Geobacillus kaustophilus
WP_010899257  4 NLRQAIMANIQGSNEQEVEATIVDAIQSGEEKMLPGLGVLFEVYWKNCNEQQKDQLCEQISQGLQ 68  Bacillus halodurans
WP_011066527  4 NLRKAIYSNISNNDEQQLEATIVDAIQNGEEKMLPGLGVLFELIWKHSDDQEKKEMIQSLESGVK 68  Oceanobacillus iheyensis
WP_011025370  2 DIKRAVLENLKRRSKEEIKGFIQEVVDSKNENAIPGLGVIFEAAWEKMTEEEKDSMMNLIMRGIS 66  Caldanaerobacter subterraneus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap