Conserved Protein Domain Family
SASP_tlp

?
TIGR03090: SASP_tlp 
small, acid-soluble spore protein tlp
This protein family is restricted to a subset of endospore-forming bacteria such as Bacillus subtilis, all of which are in the Firmicutes (low-GC Gram-positive) lineage. Although previously designated tlp (thioredoxin-like protein), the B. subtilis protein was shown to be a minor small acid-soluble spore protein SASP, unique to spores. The motif E[VIL]XDE near the C-terminus probably represents at a germination protease cleavage site. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 163133
View PSSM: TIGR03090
Aligned: 8 rows
Threshold Bit Score: 51.3413
Threshold Setting Gi: 499567249
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011024784 11 PKPDDRSDNVEKLQEMIHNTIENYREAEDYLKLHAeELSPEEIERIKEKNRNRLISIQNMRQEIIDEVHDR 81  Caldanaerobacter subterra...
WP_011064583  4 PKPDDRSDNVEKIQNTIDHTLENLNESKDYINAHAeELSSKEKDELSSKNERRKESVDGLRSEIKDEADSQ 74  Oceanobacillus iheyensis
WP_011948709  3 NKPDDRRDNVDKIQYNITKTIQNCELADEMIAKTD---DEKTKKTLIEKNERRREALDGMREEIKDEARDK 70  Clostridium botulinum
WP_003231568 11 PNPDDRSDNVEKLQDMVQNTIENIEEAEASMEFA----SGEDKQRIKEKNARREQSIEAFRNEIQDESAAR 77  Bacillales
WP_010964796  3 SKPDDRRDNVDRIQQSIDNTIENIHETNEMIENTN---REKNKDDLKAKNCRREAALDEFKSEIKDEARAK 70  Clostridium acetobutylicum
WP_010898443  2 ANPDNRNNNVERLKQMVRNTKAKMEAANEALA-HE-EMNAEERQRTEEKNNRRKQSLDAFESEILDEQSAR 70  Bacillus halodurans
WP_003199079  7 ANPDDRSDNVEKLQEMVQNTIDNFNEAKETAEVS----NEKDRAAIEAKNQRRLESIDSLKSEIKDESeyd 73  Bacillus
WP_011248032  2 AKRDDRSNNPERIENIIGNTLQNMDEARDYAKAHSeELSEEEKQEIEQKNERREQSIDGLREELKDEVNDQ 72  Bacillus clausii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap