Conserved Protein Domain Family
stp2

?
TIGR03088: stp2 
sugar transferase, PEP-CTERM/EpsH1 system associated
Members of this family include a match to the pfam00534 Glycosyl transferases group 1 domain. Nearly all are found in species that encode the PEP-CTERM/exosortase system predicted to act in protein sorting in a number of Gram-negative bacteria. In particular, these transferases are found proximal to a particular variant of exosortase, EpsH1, which appears to travel with a conserved group of genes summarized by Genome Property GenProp0652. The nature of the sugar transferase reaction catalyzed by members of this clade is unknown and may conceivably be variable with respect to substrate by species, but we hypothesize a conserved substrate.
Statistics
?
PSSM-Id: 132132
View PSSM: TIGR03088
Aligned: 6 rows
Threshold Bit Score: 543.163
Threshold Setting Gi: 500031561
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011238223   5 PLLVMHVVYRFDVGGLENGVVNLINRMPSDRFRHVVVALTQCApAFCRRIVRPDVEFISLDKPPGHGVKVYPQLFRLFRD 84  Aromatoleum aro...
WP_011288142   6 RPLIAHVVYRFDTGGLENGVINLINHMSPDRYRHAVIALTEIT-DFRKRIQRNDVQFFSLRKQPGQTFWIFPQLFRLFRQ 84  Dechloromonas a...
WP_011330820  22 RPVIVHVIFRLQTGGLENGLVNLINH-TADRYRHVIICLRDST-EFARRIRQPGLAIYALHKREGKDVALYFRLWRLLRS 99  Nitrosococcus o...
WP_011112344   4 PPLIVHVIFHLGVGGLENGLVNLINHIPADRYRHAIICLKGFS-EFHKRLNRDDVEIIALNKREGKDFSVYGKLYRVFRQ 82  Nitrosomonas eu...
WP_011310804   2 TVHIVHVVHRFDTGGMENGMVNLFNTLPPERFRHTVVALTDYS-AFRHRITAQRVDFHALNRPPGHDVGWALQLWRLLRR 80  Thiobacillus de...
WP_011712279   3 RRHLCHLVYRFDVGGLESVLVELMQRLPAERYRHSLVALTEVG-VLQQRLQGYGVAFYALHKQPGKDLAVWWRLYRLLRQ 81  Magnetococcus m...
WP_011238223  85 RRPAIVHTRNLAALEAVVPARAAGVPVRIHGEHGWDVADPGGTRRKLQFVRRLYRPFVSRYVALSRHLALYLTDAVRVPA 164 Aromatoleum aro...
WP_011288142  85 LRPAIVHSRNLAALEAQLPAWLAGVPIRIHGEHGRDVGDLDGSNITYQRIRRFYRPFVSYYLALSRDLAQYLNGIIHVPE 164 Dechloromonas a...
WP_011330820 100 LKPHIVHTRNLAALEMQGPAALAGVPIRIHGEHGWDIHDPEGKNWRYRWLRRLYQPLIHQYIALSQPIVSYLREKVGISP 179 Nitrosococcus o...
WP_011112344  83 LKPDIVHTRNLTAMEAQVVAAVAGVKARVHGEHGRDIFDLDGKNWKYNLLRKAIRPFIHHFITVSKDLENWLIDTVKVSP 162 Nitrosomonas eu...
WP_011310804  81 LKPDLVHTRNLAALEAQFVAAAAGVRATVHGEHGRDVFDLHGRNWKYNLLRRAARPLVTNYLAVSRDLEAWLRRDIGVPA 160 Thiobacillus de...
WP_011712279  82 LRPDLLHSCNLATIEGQLPAFLAGVPRRIHAEHGRDSYDLDGSNRKYRWLRRLLNPLIHHWVAVSGELHDWLAGPLKIQP 161 Magnetococcus m...
WP_011238223 165 ARVERICNGVDPARFRPSdGGRPPIAGSPFGGDDEVLVGTVGRLQAVKDQGNLVRAVAHLVSQRAPGTDRLRLIVAGDGA 244 Aromatoleum aro...
WP_011288142 165 NKMLQVYNGVDTERFTPS-GTRSPISNYPFSADDHWVIGTVGRMQTVKDQVTLARAFVRALEIAPELQPRIRLLLVGDGP 243 Dechloromonas a...
WP_011330820 180 ARIKHIYNGVDTRRFHPQr-DRSSVLPADFTGESSLIIGTVGRLEMIKDQLTLVQAFINLVRRLPKDENNLRLVIVGEGS 258 Nitrosococcus o...
WP_011112344 163 VKVHQIYNGVEHLRFHPGgTVPVEIFPPDFFAGRPFVVGSVGRMAAVKDFPTLVQAFLMLRNELSEIDRPLRLIIAGEGV 242 Nitrosomonas eu...
WP_011310804 161 HRLHQVYNGVDSVKFHPRsGPR-----PDFAHPESIVFGSVGRMVEVKNYPLLVRAFIQLMRQQPDRAERARLAIVGAGP 235 Thiobacillus de...
WP_011712279 162 AKIVTIANGVDLERFHPArADRAQLLAKSGFADEQVIALCVGRLWPVKDQANLLTALALLQQQGRLG--GLRLVLVGDGP 239 Magnetococcus m...
WP_011238223 245 SRGSIEAEVRAAGIGHAVWLAGERTDVPDVMRGLDIFALPSLAEGISNTILEAMASGLPVIATDVGGNPELVQHGVSGKL 324 Aromatoleum aro...
WP_011288142 244 LRAECQQVLDAAGIGRLAWLPGERTDIPEIMRTLDCFVLPSLAEGISNTILEAMASGLPVIATDVGGNSDLVDSGITGEI 323 Dechloromonas a...
WP_011330820 259 LRPRLEVLVAEAGMAHLVWFAGERADVPALLQAMDLFVLPSLAEGISNTILEAMATGLPVVATRVGGNPELVIDTVTGYL 338 Nitrosococcus o...
WP_011112344 243 ARAECEAMLRSAGVEQFAWLPGERDDIPQLMQAMDVFVLPSLGEGISNTVLEAMASGLPVIATRVGGNTELVLEGETGRL 322 Nitrosomonas eu...
WP_011310804 236 AREACLEMLQGAGLDHLAWLPGERDDIAAVMQALDVFVLPSKNEGVSNTILEAFASGLPVIATAVGGNVELVEHGVSGLL 315 Thiobacillus de...
WP_011712279 240 QRGALEQQVSASGLATVVRFLGTQFDVAPLMAAADLLVLPSLAEGTPLTVLEAMACGVPVVATAVGGVPALLQAGQQGAL 319 Magnetococcus m...
WP_011238223 325 VPPSDYVALADALAPY--VADGMLRRRHGDAGRGRVDAEFSLDVMVDRYAALYRTSL 379 Aromatoleum aromaticum
WP_011288142 324 IPPTDHETMAKSIVRY--ASDPGAAKAIGRAGRQRVEQKFSMNAMVAAYQGIYDQLL 378 Dechloromonas aromatica
WP_011330820 339 VPSSDSEAMAKALERY--AKNRKLAVEQGCEARRCIEERFGINAMVEQYAVLYDTLL 393 Nitrosococcus oceani
WP_011112344 323 VPSGDPVALARAISQY--HQDNTAVYKHGQHARAIIEQQFSMRSMTNGYLAVYDRVL 377 Nitrosomonas europaea
WP_011310804 316 VPSDDLDEMVRALLFY--LDSPARIGAHGKAARERAEQRFSIPAMARAYADVYEQTL 370 Thiobacillus denitrificans
WP_011712279 320 LPPGDAPALAEALQPYgvVSAKAWRRAQGAQGRARAEAQFGWARTVAAYEGLFQ--- 373 Magnetococcus marinus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap