Conserved Protein Domain Family
CH4_NH3mon_ox_A

?
TIGR03080: CH4_NH3mon_ox_A 
methane monooxygenase/ammonia monooxygenase, subunit A
Both ammonia oxidizers such as Nitrosomonas europaea and methanotrophs (obligate methane oxidizers) such as Methylococcus capsulatus each can grow only on their own characteristic substrate. However, both groups have the ability to oxidize both substrates, and so the relevant enzymes must be named here according to their ability to oxidze both. The protein family represented here reflects subunit A of both the particulate methane monooxygenase of methylotrophs and the ammonia monooxygenase of nitrifying bacteria.
Statistics
?
PSSM-Id: 132124
View PSSM: TIGR03080
Aligned: 3 rows
Threshold Bit Score: 386.887
Threshold Setting Gi: 499650248
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAL86636       7 EEILKAAKMPPEAVHMSRLIDAVYFPILVVLLVGTYHMHFMLLAGDWDFWMDWKDRQWWPVVTPIVGITYCSAIMYYLWV 86  Nitrosomonas sp...
AAG60667       5 DEILKAAKMPPEAIKMSRMIDAVYFPILCILLVGTYHMHFMLLAGDWDFWLDWKDRQYWPVVTPIVGIMYCAAIMYYLWV 84  Nitrosomonas cr...
WP_011330982   2 SALTSAVRTPEEAAKVSRTLDFIALGAFFMILLASHHVHVMLLMGDWDFWVDWKDRRFWVTVVPIVSVAYPAAAQAFFWE 81  Nitrosococcus o...
AAL86636      87 NYRQPFGATLCVVCLLIGEWLTRYWGFYWWSHYPLNFVTPGIMLPGALMLDFTMYLTRNWLVTALVGGGFFGLMFYPGNW 166 Nitrosomonas sp...
AAG60667      85 NYRLPFGATLCIVCLLVGEWLTRYWGFYWWSHYPMNFVLPSTMIPGALMLDTVMLLTRSWLVTALVGGGFFGLFFYPGNW 164 Nitrosomonas cr...
WP_011330982  82 KFRLPFGATLVTLGVLAGEWANRYFNFVGFTYFPINFVWPTILLPMALFLDAMLAISKSYGLTAVVGGLMYGLLMYPANW 161 Nitrosococcus o...
AAL86636     167 PIFGPTHLPIVVEGTLLSMADYMGHLYVRTGTPEYVRHIEQGSLRTFGGHTTVIAAFFAAFVSMLMFAVWWYLGKVYCTA 246 Nitrosomonas sp...
AAG60667     165 PIFGPTHLPVVVEGVLLSLADYTGFLYVRTGTPEYVRLIEQGSLRTFGGHTTVIAAFFAAFVSMLMFCVWWYFGKLYCTA 244 Nitrosomonas cr...
WP_011330982 162 PLLSAFHVPAEYNGVVMSLADIMGYQYVRTGTPEYIRMIEKGTLRTFGKDVVPVSAFFSGFVAMVMYFVWHFVGRWFSKD 241 Nitrosococcus o...
AAL86636     247 FFY 249 Nitrosomonas sp. GH22
AAG60667     245 FTM 247 Nitrosomonas cryotolerans ATCC 49181
WP_011330982 242 YHI 244 Nitrosococcus oceani
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap