Conserved Protein Domain Family
CH4_NH3mon_ox_B

?
TIGR03079: CH4_NH3mon_ox_B 
methane monooxygenase/ammonia monooxygenase, subunit B
Both ammonia oxidizers such as Nitrosomonas europaea and methanotrophs (obligate methane oxidizers) such as Methylococcus capsulatus each can grow only on their own characteristic substrate. However, both groups have the ability to oxidize both substrates, and so the relevant enzymes must be named here according to their ability to oxidze both. The protein family represented here reflects subunit B of both the particulate methane monooxygenase of methylotrophs and the ammonia monooxygenase of nitrifying bacteria.
Statistics
?
PSSM-Id: 132123
View PSSM: TIGR03079
Aligned: 3 rows
Threshold Bit Score: 696.669
Threshold Setting Gi: 3282846
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAG60668      19 YGVATLALTVVLDVSPVAAHGERSQEPFLRMRTIQWYDLKWGPQTTKVNDIATMTGKFHLAEDWPRAVGKPERAFFNVGS 98  Nitrosomonas cr...
AAC25092      16 IGFTAVIASSVFYIPTVAAHGEKAQAAFLRMRTIHWYDMVWSKDTIAVNETYTISGKFRVFEDWPEAVEKPHVSFLNAGQ 95  Nitrosococcus o...
WP_011111552  19 YAVAALAMTVTLDVSTVAAHGERSQEPFLRMRTVQWYDIKWGPEVTKVNENAKITGKFHLAEDWPRAAAQPDFSFFNVGS 98  Nitrosomonas eu...
AAG60668      99 PSPVFVRLSTKLNGEPTFIAGPLVIGRDYEFEVKLKARIPGRHHMHAMVNVKDAGPIAGPASWMNITGSWDDFTNPIKTL 178 Nitrosomonas cr...
AAC25092      96 PGPVTARLTSYVNGMFVPRSIGLELGGDYDFEMTMQGRRPGTWHVHTLLNVQGGGPLIGPGKYITITGDMADFENKITDL 175 Nitrosococcus o...
WP_011111552  99 PSPVFVRLSTKINGHPWFISGPLQIGRDYEFEVNLRARIPGRHHMHAMLNVKDAGPIAGPGAWMNITGSWDDFTNPLKLL 178 Nitrosomonas eu...
AAG60668     179 TGKTIDTETFNHGNGVFWHALWMGLGVFWIGYFVARPMFLPRSRVLLAYGDELLLDPMDRKVGLAVAILTCAIVWGGYRY 258 Nitrosomonas cr...
AAC25092     176 TGNTVNLETMATGTVIGWHLSWYVLGIAWIGWWARRPMFLPRYMKIKAGKANDLLTAQDKKLTIGVLVGVLLIILFGSKN 255 Nitrosococcus o...
WP_011111552 179 TGETIDSETFNLSNGIFWHVVWMSIGIFWIGVFTARPMFLPRSRVLLAYGDDLLMDPMDKKITWVLAILTLALVWGGYRY 258 Nitrosomonas eu...
AAG60668     259 TETVHPYTVPIQAGES-KVAPLPIAPN-PVAIKVTHANYDVPGRALRVTMSITNNGDTGINIGEFTTAGVRFVNALgQEH 336 Nitrosomonas cr...
AAC25092     256 AEDKFPVTIPLQAGLLgTIDSLPVDYNsMVSANVLKANYRVPGRTISMTVEITNHTDQVISIGEFNTGGIRFMNAN-VRV 334 Nitrosococcus o...
WP_011111552 259 TENKHPYTVPIQAGQS-KVAALPVAPN-PVSIVITDANYDVPGRALRVTMEVTNNGDIPVTFGEFTTAGIRFINSTgRKY 336 Nitrosomonas eu...
AAG60668     337 LDPAYPRELVA-TGLSMDDDtAIEPGETREVKMEAKDALWEVQRLMALLGDPESRFGGLLMTWDEEGNRYINSIAGAVIP 415 Nitrosomonas cr...
AAC25092     335 DETDYPEELLApEGLEVSQQ-DIAPGETVVVDISATDAAWEVQRMADVIYDPDSRFAGLIFFVDPEGNEIPIPIGGPLVP 413 Nitrosococcus o...
WP_011111552 337 LDPQYPRELIA-VGLNFDDEsAIQPGQTKELKMEAKDALWEIQRLMALLGDPESRFGGLLMSWDAEGNRHINSIAGPVIP 415 Nitrosomonas eu...
AAG60668     416 VF 417 Nitrosomonas cryotolerans ATCC 49181
AAC25092     414 TF 415 Nitrosococcus oceani ATCC 19707
WP_011111552 416 VF 417 Nitrosomonas europaea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap