Conserved Protein Domain Family
not_gcvH

?
TIGR03077: not_gcvH 
glycine cleavage protein H-like protein, Chlamydial
The H protein (GcvH) of the glycine cleavage system shuttles the methylamine group of glycine from the P protein to the T protein. Most Chlamydia but lack the P and T proteins, and have a single homolog of GcvH that appears deeply split from canonical GcvH in molecular phylogenetic trees. The protein family modeled here is observed the Chlamydial GcvH homolog, so far always seen as part of a two-gene operon, downstream of a member of the uncharacterized protein family TIGR03076. The function of this protein is unknown.
Statistics
?
PSSM-Id: 132121
View PSSM: TIGR03077
Aligned: 3 rows
Threshold Bit Score: 199.341
Threshold Setting Gi: 12229823
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9PKB2     6 YYSDYHVWIEPIHSQIVRLGLSSRMQEHLGNILHIDLPSLGASIKEGEELCVLESSKSAIEVLSPVSGEVIEVNIALEDD 85  Chlamydia muridarum...
Q9Z8B0     2 WYSDYHVWILPVHERVVRLGLTEKMQKNLGAILHVDLPSVGSLCKEGEVLVILESSKSAIEVLSPVSGEVIDINLDLVDN 81  Chlamydia pneumoniae
AAP05107   2 WDSDYHVWILPIHSDVVRLGLTARMGENLGQMLHIDLPTVGSFCKEGEVLVILESSKSAIEVLSPVSGEIIEVNEALKED 81  Chlamydophila cavia...
Q9PKB2    86 THPINHSAESEGWFVVLQLSEDFDGERFSL 115 Chlamydia muridarum str. Nigg
Q9Z8B0    82 PQKINEAPEGEGWLAVVRLDQDWDPSNLSL 111 Chlamydia pneumoniae
AAP05107  82 IQLLNNSPEESGWFMVVKLDEKLNTENLSP 111 Chlamydophila caviae GPIC
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap