Conserved Protein Domain Family
PS_II_S4

?
TIGR03069: PS_II_S4 
photosystem II S4 domain protein
Members of this protein family are about 265 residues long and each contains an S4 RNA-binding domain of about 48 residues. The member from the Cyanobacterium, Synechocystis sp. PCC 6803, was detected as a novel polypeptide in a highly purified preparation of active photosystem II (Kashino, et al., 2002). The phylogenetic distribution, including Cyanobacteria and Arabidopsis, supports a role in photosystem II, although the high bit score cutoffs for this model reflect similar sequences in non-photosynthetic organisms such as Carboxydothermus hydrogenoformans, a Gram-positive bacterium. [Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 132113
View PSSM: TIGR03069
Aligned: 13 rows
Threshold Bit Score: 361.234
Threshold Setting Gi: 18404337
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_564622     44 PLRQSALRRCYSAEaikgdvdfllkgvgdqavakEVKQILEMARRASSKREVLHTDFLTPPIVKESVSLLEKFADVKIVA 123 thale cress
WP_011127401  35 LPREDLLTKARHPE--------------------GLAALLDLAEQVLRTWQPSWSDFLDAPLQEEALKRLSDLSELAWHR 94  Synechococcus s...
WP_011130801   3 LPRQELLKGCLDPQ--------------------GMEALLVQADTVLRTWQPSWSAFVSAPLREEALHRFSTLTDLHWHA 62  Prochlorococcus...
WP_010872783   2 LPREALLKGAPDRE--------------------AIARVIDQAEQALRTWEVVVSDFCAPPLIAEIQTRFDSLTELHFLP 61  Synechocystis s...
WP_011365097   2 LPREELKAGTQNPE--------------------ELTLLVDLAEQVLRTWQPAWSPFLSAPLREEAMARLGSLSELTWMS 61  Synechococcus s...
WP_011359341   3 LLKEELLTGADDPA--------------------GLRQLIQLADQVVRTWQPAWSPFLDARLQEEALERLSNLSEIGWHR 62  Synechococcus s...
WP_011378057   2 LPRQDLLAGADNRD--------------------CLARLIDLAEQSIRTWEPAISDFLSPPELAEAQERLGRLTELQLLP 61  Synechococcus e...
WP_010997041   2 LPREELLKGVENRD--------------------SVARVIDQAEQAIKTWEVVVTDFLSPPELAEIQRVFSRLTDVQLVA 61  Nostoc sp. PCC ...
WP_011376998   2 IDLKEILINSNYKE--------------------ETEELINIANLAYKHWETYWTGFNSTYVCEEISKDFENLNDFKFFV 61  Prochlorococcus...
WP_011140394   5 LPREELLKRAEHRD--------------------ALARVLDLAETALRDWSVVTSDFYSPPEVGECLDVFSRLVEVHAAA 64  Gloeobacter vio...
WP_011125589   3 LSRKKLLKGCIYPK--------------------KIEQLLIETEHVLKTWTPIWTSFLSAPVQEEIKNVFKEIADISYSS 62  Prochlorococcus...
WP_011132990   2 IDLKELLINSNYKK--------------------EIEELINISNLSLKHWQTYWTGFNSTFVCEEILKEFENLNDFKFFV 61  Prochlorococcus...
WP_011295276   3 LPKEKILFKSPFHK--------------------ELETLLHFAEKALSERTAIWSPFLSAQLIEEVKDRFNNLNDISLLF 62  Prochlorococcus...
NP_564622    124 QGGYPEAERCRISIGHPDVLt-SDpDI------VAALSITGNFGFQPCSHGDFLGAILGTGISREKLGDILIQEEKGAQV 196 thale cress
WP_011127401  95 DGGHQGAERCRLLCHRRDQP--VE-STp----pIQGLLIEGNFLFDPLTPEDLRSALHNMGAQPEDLGDLWVRGDRGGQG 167 Synechococcus s...
WP_011130801  63 DGGHPGAERQRLCCWRSEDH--HHpTPsqa-apIHGLLLHGNFLFDSPSPTDLRQALEAIDAQPEQLGDLWIRGDRGAQA 139 Prochlorococcus...
WP_010872783  62 WGGYPQAERQRLAIARAEIP--LEtEQi----pLTALDVAGNFLFDPASHRDFLGALLGTGLVREKVGDIILLGERGAQA 135 Synechocystis s...
WP_011365097  62 DGGYPGAERQRLLCHRRDDS--PDaEp-----pIQGLLIEGNFLFDPLSPEDLREALQTMGVDADNIGDLWVRGDRGGQG 134 Synechococcus s...
WP_011359341  63 DGGYPGAERCRFLCQRRDPI--GDaDTca---pVQGLLIEGNFLFDPLSPEDIRNALQELGAAPDQIGDLWVRGDRGGQG 137 Synechococcus s...
WP_011378057  62 WGGYPQAERQRLAIARSEMP--LDvDQi----aIAAVEIAGNFLFDPASHRDFLGSLLGTGLVREKVGDILVLGDRGAQA 135 Synechococcus e...
WP_010997041  62 WGGYPQAERQRLAIARAELP--LDqSQv----sLLVLEIAGNFLFDSATHRDFLGAMLGTGIVREKTGDIIVLGERGAQA 135 Nostoc sp. PCC ...
WP_011376998  62 YGGFSSSQRSRIACFRGDNI--PEeDAlksnfpAQGIKINGNFLFDNATQDDFRSLLIENGVHKVKVGDIWTIGDRGAQG 139 Prochlorococcus...
WP_011140394  65 WGGYSQAERQRIAVSRDNIA--IEtAAi----pLAAVDIRGNFLFDAASHRDFLGAILGTGIVRGKVGDILVLGDRGAQT 138 Gloeobacter vio...
WP_011125589  63 NGGYPNAERKRILLQRQQNEtfLNdENv----pIKAIKIEGNFLFDRTEPEDFRQSIAETGVKAEEIGDLWITGDRGAQA 138 Prochlorococcus...
WP_011132990  62 FGGYNSAQRSKIACFREDNT--PEkNElikdfpAKGFQMNGNFLFDNATQDDFRSLLVDNGLREERIGDIWTIGDRGAQG 139 Prochlorococcus...
WP_011295276  63 EGGFPSAERKRICFLRSVEEm-HSpSIei---pIKGIYIKGNFLFDRAKQSDFRDLIHELHDQADDIGDIWLIRDRGAQA 138 Prochlorococcus...
NP_564622    197 LIVPELVDFVVTALDKVGNVGVTCSKIPLLALEYEPPRT-NSFKTVEASLRIDAVASAGFKISRSKLVDLISSKDVRVNW 275 thale cress
WP_011127401 168 LISPNAAELLQGRRGQLRDVEIHCDVLEITQLQLPAQRNpKRLTTVEASCRIDAIASAGFGLSRSKVVSQIKAGRLRLNW 247 Synechococcus s...
WP_011130801 140 LCTPELAVNLDGRSSRVREVEITCEAVAVAQLQPPAHRLtRRLNSVEASCRIDAIASAGFGLSRAKVVNQIKQGHLRLNW 219 Prochlorococcus...
WP_010872783 136 IVVPEVAEFISLHLTQVRTVPVKAKAIALEELKIRPPKT-KEMTTVEASLRLDAIASAGFGLSRSKMADAVTQGNVQVNW 214 Synechocystis s...
WP_011365097 135 ICTPSAAKALHGRLGAVREVEIRCESRPLEQLQQPVQRSvRTLQTVEASCRLDAIASAGFGLSRAKIVTHVKAGRLRLNW 214 Synechococcus s...
WP_011359341 138 LCTPESAARLHEQRGRVRDVEIRCEALPIEALHLPAQRTpRILQTVEASCRIDAIASAGFGLSRAKIVGHIKAGRLRVNW 217 Synechococcus s...
WP_011378057 136 LVMPELVEFLGLQLTQVRSVPVKVREIPLAELRIPAPRI-KQLTTVEASLRLDAIASAGFGLSRSKMVDLINRGEVRVNW 214 Synechococcus e...
WP_010997041 136 IVVPELAEFLQIHLNQVRSVPVKTQPIELTELKVREPKk-KELTTVEASLRLDAIASAGFGMSRSKMVDFIDSGDVRVNW 214 Nostoc sp. PCC ...
WP_011376998 140 IIDNLDIEHLNEKIFYLRDVKVKINLVGIDELQIPSGRTkKLVNTVEASTRLDAIASAGFRISRTKIIERIENGMLKLNG 219 Prochlorococcus...
WP_011140394 139 LVAPELVPFLQTSLTSVRTVPVQVVPIGFEELRIRPPQT-KEITSVEASLRIDAIGSAGFGLSRNKMVESIEAGEVTLNW 217 Gloeobacter vio...
WP_011125589 139 MCTPEALKLLQNNQGFIRDVEIKYKSIDLTDLRIPFQRNpKKITSVEASKRLDAIASAGFGISRAKIISQIREGRVRLNW 218 Prochlorococcus...
WP_011132990 140 IIDDSKIEFLDEKIFSLRDVKVKIKIVSLDELQIPAGRSkKIINTVEASTRIDAIASAGFRISRNKILERIETGMLKLNG 219 Prochlorococcus...
WP_011295276 139 ICTKKCADSINQKIGKLREVEIIIHALDLNEMEIPFNRPeKVINTVEASTRIDAIASAGFGLSRSKIIKQIKEGCLRLNW 218 Prochlorococcus...
NP_564622    276 ATVTKNGTIVKTGDVVSVSGKGRLKIGEINETKKGKFAVEIIR 318 thale cress
WP_011127401 248 EPVLQGSRELKVGDRLQLQDRGSLELLSCTLTKRERWRIELMR 290 Synechococcus sp. WH 8102
WP_011130801 220 EPVRQTSRELVVGDRLQLQGRGTLKVLALEMTKRQRWRVEMLR 262 Prochlorococcus marinus
WP_010872783 215 KPVTQSSYALKAGDLVTYRGKGRLEIGEITVTKKERYRIQLTR 257 Synechocystis sp. PCC 6803
WP_011365097 215 GNVRQASRELVVGDRLQLQDRGSVEVLSLTRTKRERWRVELRR 257 Synechococcus sp. CC9605
WP_011359341 218 HDVRLASRDVGVGDRLQLQDRGALEVLSLTRTKRERWRVELRR 260 Synechococcus sp. CC9902
WP_011378057 215 KAATQPSTQLKTGDLVAVRGKGRLAIGDVQVTKKERYRLELTR 257 Synechococcus elongatus
WP_010997041 215 KEVTQASSQVKSGDLIAIRGKGRLEVGEIAVTKKERYRVQLTR 257 Nostoc sp. PCC 7120
WP_011376998 220 SKVNKPTINLKIGDKLELENKGFIEILNLEITKRERWKVKLLR 262 Prochlorococcus marinus
WP_011140394 218 KTVTQPSKNVQTGDRITLRGRGRLEVGPVDTTKKGRYRVQMIR 260 Gloeobacter violaceus
WP_011125589 219 HTINNASRALTIGDRVDLEGKGSIEVLNLEITKKDRWRVELIR 261 Prochlorococcus marinus
WP_011132990 220 KTVKKGTISLKVGDKLQLDNKGFIEILDLEITKRERWKIKLLR 262 Prochlorococcus marinus
WP_011295276 219 ALNDQPSKSVNIGDLIHLEKKGSLKILNIDKTKKERWRIKLLR 261 Prochlorococcus marinus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap