Conserved Protein Domain Family
srtB_sig_NPQTN
?
TIGR03068: srtB_sig_NPQTN 
sortase B signal domain, NPQTN class
This model represents one of the boutique (rare) sortase signals, recognized by sortase B (SrtB) rather than by the housekeeping-type SrtA class sortase. This sequence, beginning NPQTN, shows little similarity to several other SrtB substrates.
Links
?
Statistics
?
PSSM-Id: 132112
Aligned: 2 rows
Threshold Bit Score: 68.2294
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Download Cn3D
PubMed ReferencesClick to see Conserved Features Help
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection: 
WP_000789823 189 NPQTNAGTPAYIYTIPVASLALLIAITLFVRKK 221 Staphylococcus aureus
WP_014532602 109 NPQTNAGTPAYIYAIPVASLALLIAITLFVRKK 141 Staphylococcus aureus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap