Conserved Protein Domain Family
Gem_osc_para_1

?
TIGR03066: Gem_osc_para_1 
Gemmata obscuriglobus paralogous family TIGR03066
This model represents an uncharacterized paralogous family in Gemmata obscuriglobus UQM 2246, a member of the Planctomycetes. This family shows sequence similarity to TIGR03067, which is also found in Gemmata obscuriglobus as well as in a few other species. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 132110
View PSSM: TIGR03066
Aligned: 9 rows
Threshold Bit Score: 88.6001
Threshold Setting Gi: 497735131
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010033969   1 MALALAA--GTAAGAADEKFDAKK-LIGKWQPikskkgedkSKKSESMVVEFTKDGKVVLTDG-A-EG-KEVKIEGTYKL 74  Gemmata obscuri...
WP_010048359   9 TLFVLAG--SLSAGDNEPVLDPAK-LVGKWEAk-------gDPEKRLVVFEFEEQGGLVVRIT-R-KG-EESKAAGKYQI 75  Gemmata obscuri...
WP_010043812   9 VLVFCGP--LVADDKKDEKIDPAK-LLGKWTT----------KERDFAVIEFLKGGKLVLRHG-D-GK-EEVAFDGTYKL 72  Gemmata obscuri...
WP_010040285   9 AALALCG--WTRADDKDEKIDAKK-LVGKWTTe-------nKELGAKLIVNFAKDGKLAITVK-A-KGeKDVQIKGTYKL 76  Gemmata obscuri...
WP_010039341   9 LTALLVAaaGVGADDKVEKIDAGK-LIGKWHP----------KEKKDVVIEFKKEGKLGLTLG-E-GD-KAFKAEGTYKL 74  Gemmata obscuri...
WP_010048157  10 aAVAFGG--WGRADEPKKAEDVKTaVVGKWET----------ADKDRVPLEIRADGTIGVPFRsE-NG-KWVMADGTYTV 75  Gemmata obscuri...
WP_010049315   7 aVFAFAA--LGLVGTVPAKADDTPkLLGKWEVtk-----saSDTPVGTVIEFAKDGKLLVTIN-N-EG-KDLKLDGTYKL 76  Gemmata obscuri...
WP_010033971   1 --------------MPKERSDAEK-VVGTWRMtld----ssGGTSTDVELDFYQGGKMVIRQR-LgNG-RVSLYEGSYRV 59  Gemmata obscuri...
WP_010035924   2 VVLVASF--GLSASDKDEKIDAKL-LVGKWTMe-------nEETGASMVMEFTKDGKFKVSVK-EkKG-KEIQIGGTYKL 69  Gemmata obscuri...
WP_010033969  75 EGD-KLTFALKVLGEEVKDTVTLTKLTDDEMAGKSKDNEEAAFKKVK 120 Gemmata obscuriglobus
WP_010048359  76 EGR-TLTLTLKIAGVEDSRSVTVAKLTDGQLFGTGEKGRPLLLVRMR 121 Gemmata obscuriglobus
WP_010043812  73 DGN-KLTVNAQPGGKEEKSTVTIKKLTDSEMVVISDTGKDVVMNRVK 118 Gemmata obscuriglobus
WP_010040285  77 TGN-QLTMTMEGDGKEHKETLTVLELDEDDLVTKDPKGNKDTYKRVE 122 Gemmata obscuriglobus
WP_010039341  75 DGN-KLTTTLKAGAQEKTNTITISKLTDTELTGKDENGKEDTLVRIK 120 Gemmata obscuriglobus
WP_010048157  76 DAAgKVTYKAASGGSTLGG---WYQYKDGGLVSAMGPKNRVTWKRVE 119 Gemmata obscuriglobus
WP_010049315  77 TGK-KIALKLSLNEQKIEQDLTVTFKGEDGMELEDADKKVDTLKKKK 122 Gemmata obscuriglobus
WP_010033971  60 VGN-ELPYEVNQGGAVKKETLTIKKLTTHELIVVDPDGLKEEFVRIK 105 Gemmata obscuriglobus
WP_010035924  70 EGA-KLMLTIKAGDKEAKETLTVVSLDDEELVTKDSKGKKDTYERVD 115 Gemmata obscuriglobus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap