Conserved Protein Domain Family
bchO_mg_che_rel

?
TIGR03056: bchO_mg_che_rel 
putative magnesium chelatase accessory protein
Members of this family belong to the alpha/beta fold family hydrolases (pfam00561). Members are found in bacterial genomes if and only if they encoded for anoxygenic photosynthetic systems similar to that of Rhodobacter capsulatus and other alpha-Proteobacteria. Members often are encoded in the same operon as subunits of the protoporphyrin IX magnesium chelatase, and were once designated BchO. No literature supports a role as an actual subunit of magnesium chelatase, but an accessory role is possible, as suggested by placement by its probable hydrolase activity. [Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 132100
View PSSM: TIGR03056
Aligned: 3 rows
Threshold Bit Score: 439.326
Threshold Setting Gi: 499657384
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011388246  16 TWPHRDCSRFVTVGGFHWHVQSMGPTAGgngkggdaPLLLLVHGTAATTHSWRDLMGPLARSFRVVAIDLPGHGFTRAPF 95  Rhodospirillum ...
WP_013066419   9 NWPYRSAAARRRVGPIDWWVIDTGPADG--------PVLLLLHGLGASGHSFRKMIPGLSARYRVIVPDLPGHGCSRSTA 80  Rhodobacter cap...
WP_011338118   9 DWPGRESMRRIDCPPHQWCVRDEGR--G--------PTALLLHGAGGSSHSWRHLVPLLAPHFRVVAPDLPGQGFTRAGQ 78  Rhodobacter sph...
WP_011388246  96 SFRPTLPSMAKALSALLAAEGLSPDGVVGHSAGAAILARMVLDGSVtPRmLVSINGAFMPFPGMAGTLFPYMARVLFCNP 175 Rhodospirillum ...
WP_013066419  81 RNRFGLKPMAEDLWKLCQHLNVTPAAVIGHSAGGAIALQLALDTPV-PR-VVGINAALDHFEGVAGVVFPMMARGLAALP 158 Rhodobacter cap...
WP_011338118  79 R-RFSLEAMAEDLARLCAAEDWRPSVLIGHSAGAALALRLAEILPVrPRaVVGINAALGNFEGTAGWLFPLIAKLLALNP 157 Rhodobacter sph...
WP_011388246 176 LTPYMMSWGAADQQRVERLIRDTGSLLDKPGMTYYGRLMRSPAHVSSALSMMAHWDLAPLNRDMRRLTIPLHLIVGEEDK 255 Rhodospirillum ...
WP_013066419 159 FTAPLVTRFGASRQRIGQLLDMTGSVIDAAGKAYYTALIQTPEHVDGGLRMMAQWELGPLIGALPRIAKPVFLIAGNGDR 238 Rhodobacter cap...
WP_011338118 158 FIPPMAARLFGAEDRVRRLIGSTGSDLDEAGLRQYMTLIGDHVHVDGTLSMMAQWRLDALQRRLPAIDVPTLLIAAAKDG 237 Rhodobacter sph...
WP_011388246 256 AVSPDEAKRLATRVATATLHVVPGgGHLVHEEQPDLVVGLIEQAAR 301 Rhodospirillum rubrum
WP_013066419 239 AVPAHVSADAARFLPMATLRRIDG-GHLIHEVAADGLSGMILDWLE 283 Rhodobacter capsulatus
WP_011338118 238 TVPPRISQEAAGRMPFGSYVEMPGlGHLAHEEDAAGVAAILLPFVE 283 Rhodobacter sphaeroides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap