Conserved Protein Domain Family

TIGR03052: PS_I_psaI 
photosystem I reaction center subunit VIII
Members of this protein family are PsaI, subunit VIII of the photosystem I reaction center. This protein is found in both the Cyanobacteria and the chloroplasts of plants, but is absent from non-oxygenic photosynthetic bacteria such as Rhodobacter sphaeroides. Species that contain photosystem I also contain photosystem II, which splits water and releases molecular oxygen. [Energy metabolism, Photosynthesis]
PSSM-Id: 132096
Aligned: 12 rows
Threshold Bit Score: 34.625
Threshold Setting Gi: 1346829
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P48116        3 SNLPSILVPMVGIVLPAIVMALLFVYIETDE 33  Cyanophora paradoxa
P49484        4 AFLPSILVPLVGLIFPAFSMALFFIYISADD 34  Odontella sinensis
P51387        4 AYLPSILVPLVGLIFPALGMALLFIYIERET 34  Porphyra purpurea
P13165        4 LNLPSIFVPLVGLVFPAIAMTSLFLYVQKKK 34  Hordeum vulgare
P0A428        8 SFLPWIFIPVVCWLMPTVVMGLLFLYIEGEA 38  Synechococcus elongatus
CAE08632      8 AWLPAIFVPITGIVFPAVFIVLVGRVITAAE 38  Synechococcus sp. WH 8102
O87786        8 TWLPAVFVPLIGLVTPAVFIVLIGRYITATD 38  Prochlorococcus marinus subsp. marinus str. CCMP1375
CAE21942      8 TWLPAVFVPLIVLVTPAIFIVLVGRHITATD 38  Prochlorococcus marinus str. MIT 9313
CAA05411      7 TFLPSIFVPLIGLVTPAVFLVLIGRLITATD 37  Prochlorococcus marinus subsp. pastoris str. CCMP1986
WP_011618369  8 AWLPVLFVPMIGIVFPAVFIILVGRAITAAD 38  Synechococcus sp. CC9311
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap