1S5L


Conserved Protein Domain Family
PS_II_CP47

?
TIGR03039: PS_II_CP47 
Click on image for an interactive view with Cn3D
photosystem II chlorophyll-binding protein CP47
[Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 163117
View PSSM: TIGR03039
Aligned: 6 rows
Threshold Bit Score: 852.975
Threshold Setting Gi: 499455528
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1S5L_B         1 MGLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSI 80  Thermosynechoco...
WP_011142992   1 MGLPWYRVHTVVTSDPGRLIAVHLMHTALVAGWAGSMAFFEASVFNPEDPVLDPMWRQGMYVIPFMARLGVINSWSGWSV 80  Gloeobacter vio...
WP_011131952   1 MGLPWYRVHTVVINDPGRLLAVHLMHTALLAGWAGSMALYELAIFDPSDAVLNPMWRQGMYVMPFMARLGITSSWNGWDI 80  Prochlorococcus...
WP_011131032   1 MGLPWYRVHTVVINDPGRLLAVHLMHTALLAGWAGSMALYELAIFDPSDPVLNPMWRQGMYVMPFMTRCGITGSWGGWSI 80  Prochlorococcus...
WP_011243145   1 MGLPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGSMALYELAIFDPSDAVLNPMWRQGMFVLPFMARLGVTQSWGGWSI 80  Synechococcus e...
WP_010994315   1 MGLPWYRVHTVVLNDPGRLISVHLMHTALVAGWAGSMALYELAIYDPSDPVLNPMWRQGMFVLPFMARLGVTQSWGGWSV 80  Nostocaceae
1S5L_B        81 TG-------ETGIDP-----GFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGL 148 Thermosynechoco...
WP_011142992  81 FGpftadglGNRIDPnvanvGFWSFEGVAAAHIVLSGLLFLAACWHWVNWDLELFRNPRNGELGLDLPKIFGIHLLLSGL 160 Gloeobacter vio...
WP_011131952  81 TG-------ATGVDP-----GFWSFEGVAAAHIVFSGLLMLASIWHWTYWDLDLWEDERTGEPALDLPRIFGIHLLLSGI 148 Prochlorococcus...
WP_011131032  81 TG-------ETGVDP-----GLWSFEGVAAAHIIFSGLLMLAAIWHWTYWDLDLWLDPRTQEPALDLPKIFGIHLTLAGA 148 Prochlorococcus...
WP_011243145  81 TG-------ETAVDP-----GYWSFEGVAIAHIVLSGLLFLAAVWHWVYWDLELFTDPRTGEPALDLPKMFGIHLFLSGL 148 Synechococcus e...
WP_010994315  81 TG-------GTATDP-----GFWSFEGVAAAHIVLSGLLFLAAVWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLSGL 148 Nostocaceae
1S5L_B       149 LCFGFGAFHLTGLfgpGMWVS-DP-------YG---------LTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGII 211 Thermosynechoco...
WP_011142992 161 ACFGFGAVHMQTI---GMWVSaDPiyvelgkYGnllqgmnpeALGVVVPTGFAWGADGFNPYNPAGIAAHHVAAGIVGIL 237 Gloeobacter vio...
WP_011131952 149 TCFGFGAFHCANV---GIWIS-DP-------YG---------LTGHVEQVAPSWGADGFNPFNPGGIVANHIAAGLLGII 208 Prochlorococcus...
WP_011131032 149 VCFGFGAFHLSGLygpGMWVS-DS-------YG---------LTGHMENVAPEWGAAGFNPFSPGGIVANHIAAGIFGFL 211 Prochlorococcus...
WP_011243145 149 LCFGFGAFHLSGLwgpGMWVS-DP-------YG---------LTGHVQPVAPAWGPEGFNPFNPGGIVAHHIAAGVVGIV 211 Synechococcus e...
WP_010994315 149 LCFGFGAFHLTGLfgpGMWIS-DP-------YG---------VTGSVQPVAPEWGPDGFNPFNPGGVVAHHIAAGIVGII 211 Nostocaceae
1S5L_B       212 AGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQAS 291 Thermosynechoco...
WP_011142992 238 GGIFHIAVRPPERLYRALRMGNIETVLASALAAVFFAAFVVAGTFWYGTATNPVELFGPVRYFWDAQVYDKKVNELVTAN 317 Gloeobacter vio...
WP_011131952 209 GGIFHITNRPGERLYRALKLGSLEGVLASALAAVLFVSFVVAGTMWYGSATTPIELFGPTRYQWDSGYFKTEINRRVQTA 288 Prochlorococcus...
WP_011131032 212 GGHFQMLNRPPERLYKALRMGNIETVLASGCAAVCAIAFIVSGTMWYGSAATPVELFGPTRYQWDQNFYRTEINRRVQSA 291 Prochlorococcus...
WP_011243145 212 AGLFHLTVRPPERLYKALRMGNIETVLSSSLAAVFFAAFVVAGTMWYGNAATPVELFGPTRYQWDQGYFRQEIARRVDTA 291 Synechococcus e...
WP_010994315 212 AGLFHLTVRPPERLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGNATTPIELFGPTRYQWDQGYFHQEIERRVQSS 291 Nostocaceae
1S5L_B       292 LASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILT 371 Thermosynechoco...
WP_011142992 318 VAKGMSRAEAENAVPLRLRFYDYVGNSPAKGGLFRGGPMNNGDGVATGWLGQPVFKDKEGRELRVVHLNTLYETQPVVLV 397 Gloeobacter vio...
WP_011131952 289 IDNGATKEEAYASIPEKLAFYDYVGNSPAKGGLFRVGALVNGDGLPTGWQGHIAFTDKEGNDLEVRRIPNFFENFPVILE 368 Prochlorococcus...
WP_011131032 292 MDEGATQEAAYAAIPEKLAFYDYVGNSPAKGGLFRVGAMVNGDGLATGWLGHITFKDKAGNDLQVRRIPNFFENFPVLLE 371 Prochlorococcus...
WP_011243145 292 VASGASLEEAWSSIPEKLAFYDYVGNSPAKGGLFRTGQMNKGDGIAQGWLGHAVFKDKNGDVLDVRRLPNFFENFPIVLT 371 Synechococcus e...
WP_010994315 292 VAQGASLSEAWSQIPEKLAFYDYVGNSPAKGGLFRTGPMVKGDGIAQSWQGHGVFKDAEGRELTVRRLPNFFETFPVILT 371 Nostocaceae
1S5L_B       372 DKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTEtlNSDGIFRTSPRGWF 451 Thermosynechoco...
WP_011142992 398 DSNNIPRADIPFQRSESQLSFEQTGVTVSFVGGKLNGQSFEDPAQVKSYAKRAQLGELIEFDTK--DADGVFRTSTRGWF 475 Gloeobacter vio...
WP_011131952 369 DKEGNVRADIPFRRAEAKYSFEQTGITATIYGGDLNGQTFTDPAVVKRLARKAQLGEAFKFDREtyKSDGVFRSSPRAWF 448 Prochlorococcus...
WP_011131032 372 DQNGVVRADIPFRRAEAKNSFEQQGVTATIYGGSMDGKTFTDTADVKRLARKAQLGEAFTFDREtyASDGVFRSSPRGWF 451 Prochlorococcus...
WP_011243145 372 DSKGAVRADIPFRRAEAKFSFEETGITASFYGGSLNGQTITDPAQVKKYARKAQLGEAFEFDTEtlNSDGVFRTSPRGWF 451 Synechococcus e...
WP_010994315 372 DADGVVRADIPFRRAESKYSFEQSGVTVSFYGGDLDGKTFTDPADVKKYARKAQGGEIFEFDREtlNSDGVFRTSPRGWF 451 Nostocaceae
1S5L_B       452 TFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSpEQVEWGFYQKVGDVTTR 505 Thermosynechococcus elongatus
WP_011142992 476 VLAHGIFALLFFFGHIWHGARTLFLDVFTGVDPTRQeEEFEYGVFKKLGDPTTR 529 Gloeobacter violaceus
WP_011131952 449 TYAHLCFGLLFLFGHWWHASRTLYKDSFAGIDSEIG-DQVEFGLFKKLGDETTR 501 Prochlorococcus marinus
WP_011131032 452 TFAHVNFALLFLFGHWWHAARTLYRDVFAGIDPDLG-DQVEFGVFQKLGDSSTR 504 Prochlorococcus marinus
WP_011243145 452 TFGHASFALLFFFGHIWHGSRTLFRDVFAGIEADLG-EQIEFGAFQKLGDPTTR 504 Synechococcus elongatus
WP_010994315 452 TFGHAVFALLFFFGHLWHGARTIYRDVFAGVEADLE-EQVEWGLFQKVGDKSTR 504 Nostocaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap