Conserved Protein Domain Family
anthran_nbaC

?
TIGR03037: anthran_nbaC 
3-hydroxyanthranilate 3,4-dioxygenase
Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase. This enzyme acts on the tryptophan metabolite 3-hydroxyanthranilate and produces 2-amino-3-carboxymuconate semialdehyde, which can rearrange spontaneously to quinolinic acid and feed into nicotinamide biosynthesis, or undergo further enzymatic degradation.
Statistics
?
PSSM-Id: 132082
View PSSM: TIGR03037
Aligned: 5 rows
Threshold Bit Score: 291.676
Threshold Setting Gi: 445969877
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011301610  10 LNFKRWLDDHADKLKPPVGNQQIWQDSDMMVTVVGGPNERSDFHDDPIEELFYQFKGNAYLL-LWEDGRYERVDLREGDM 88  Cupriavidus pin...
WP_011551040   7 INFKKWIDEHRHLLKPPVGNQQVWEDREFMVTVVGGPNARTDFHINEGEEFFYQLEGTMNLR-VIDEGQVQDIPIHEGEI 85  Myxococcus xanthus
WP_011047507   7 FNFQKWIDEHKHLLKPPVGNQQVWEDADLMVTVVGGPNKRTDYHDDPVEEFFYQLKGDMVLK-LYEGGEFYDVPIREGDI 85  Ruegeria pomeroyi
WP_011036739   6 INLHAWVEQHRHLLKPPVGNKCI-QQDGFIIMIVGGPNARTDYHYDEGPEWFFQLEGEMVLK-VQDDGTARDIPIRAGEI 83  Xanthomonas cam...
WP_000047732   8 FNLLKWIDENKELLKPPVNNKVIWQDSEFIAMILGGPNRRRDFHVDPSDEFFYQIKGECYVEcITEEGKREVVTVKEGDV 87  Bacillus cereus
WP_011301610  89 LLLPPHTLHSPQRPeADSRCLVVERKRPQGQNDAFQWSCASCGTIVQRHEVTLQSIVADLPPLYEKFYaSSEDARRCPGC 168 Cupriavidus pin...
WP_011551040  86 FLLPPNVPHSPQRP-AGTVGLVLERRRQPKELDGFMWLCPQCGEKLYEEFVHVTNLVTQLPPIFEHFY-GNPDNCTCKKC 163 Myxococcus xanthus
WP_011047507  86 FLLPPHVRHSPQRPqEGSIGLVIEPKRPEGAHDAIEWFCFGCGSLVHRAELLLESIVRDLPPVYQAFY-ADEQARTCPNC 164 Ruegeria pomeroyi
WP_011036739  84 FLLPPKVPHSPQRA-AGSIGLVIERERLPHEQDGLQWYCPQCNHKLYEAMFPLENIETDFPPVFDHFY-RSLALRTCTQC 161 Xanthomonas cam...
WP_000047732  88 FMLPAMVPHSPHRV-ANTYGLVIERKRNQGELEDFVWFCDECNHEMHRVRVQLSDIEKQVKEAIHSFN-SNKEIRACKNC 165 Bacillus cereus
WP_011301610 169 GE 170 Cupriavidus pinatubonensis
WP_011551040 164 GT 165 Myxococcus xanthus
WP_011047507 165 GE 166 Ruegeria pomeroyi
WP_011036739 162 GH 163 Xanthomonas campestris
WP_000047732 166 GH 167 Bacillus cereus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap