4CZ1,4COB


Conserved Protein Domain Family
trp_arylform

?
TIGR03035: trp_arylform 
Click on image for an interactive view with Cn3D
arylformamidase
One of several pathways of tryptophan degradation is as follows: tryptophan 2,3-dioxygenase (1.13.11.11) uses 02 to convert Trp to L-formylkynurenine. Arylformamidase (3.5.1.9) hydrolyzes the product to L-kynurenine and formate. Kynureninase (3.7.1.3) hydrolyzes L-kynurenine to anthranilate plus alanine. Members of the seed alignment for this model are bacterial predicted metal-dependent hydrolases. All are supported as arylformamidase (3.5.1.9) by an operon structure in which kynureninase and/or tryptophan 2,3-dioxygenase genes are adjacent. The members from Bacillus cereus, Pseudomonas aeruginosa and Ralstonia metallidurans were characterized. An example from Pseudomonas fluorescens is given the gene symbol qbsH instead of kynB because of its role in quinolobactin biosynthesis, which begins with tryptophan. All members of this family should be arylformamidase (3.5.1.9). [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 132080
View PSSM: TIGR03035
Aligned: 9 rows
Threshold Bit Score: 359.809
Threshold Setting Gi: 489907096
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4CZ1_A         5 KWIDISQPLNNDIATWPGDTPFSYEVLWSKEESGSVNVGKLTMSIHTGTHIDAPFHFDNDGKKVLDLDIQVYVGPTRIID 84  Bacillus anthra...
WP_003114853   5 RYWDISPALDPNTPTWPGDTPFQQEWAARLDEQCPVNVGRITLSPHTGAHVDGPLHYRADGLPIGQVPLDIYMGPCRVIH 84  Pseudomonas aer...
WP_011059116   6 RWWDISPPLSTATPTWPGDTPFQEERVWQFGPECPVNVGRVTLSPHTGAHVDAPLHYRPDGLPIGEVSLDVYMGPCRVLH 85  fluorescent pse...
WP_011000714   4 TLWDISPALSTATPTWPGDTPFSQEIAWKLEGDCPVNVGRITLSPHTGAHADAPLHYHADGAPIGAVPLDAYLGPCRVIH 83  Ralstonia solan...
WP_011245507   9 RWIDVSQPLNEKLAHWPGDLPYSYQLTFSKQQTGSVNIGQMAMSVHSGTHVDAPFHFKNDGAKITDLDIHVFIGKARVVD 88  Bacillus clausii
WP_011065163   3 VWIDISQPINNNLACWPGDQSFHFHTPVTKEMTGSVNIGRITTSTHVGTHADAPYHFMEDGKRILDLEIDRYIGPCKVID 82  Oceanobacillus ...
WP_004534233  32 TIWDISPPIAPATPVWPGDTPVGIERVWRIEAGSPVNVARVTLSPHTGAHADAPLHYDADGAPIGAVPLDAYLGRCRVIH 111 Burkholderia ps...
WP_003810518   3 RLWDISPPVSADSPVFPGDTPYRQQWKWSLTPDCPVNVSEITLSPHIGAHADAPLHYENGAAAIGAVALEPFLGPCRVIH 82  Bordetella
4COB_A         7 RYWDISPALDPNTPTWPGDTPFQQEWAARLDEQCPVNVGRITLSPHTGAHVDGPLHYRADGLPIGQVPLDVYMGPCRVIH 86  Pseudomonas aer...
4CZ1_A        85 -VSNLESIGKKELEKFHLEGVERLLLRTSSHGKANeFPDIIPHLRADIAPFLSEKGIRLIGVDVPSVDPLDDKELAAHHQ 163 Bacillus anthra...
WP_003114853  85 cIGANPLVTPEHLAGQLDDLPSRVLLRTFERVPAN-WPEGFCAIAPATIECLAERGVRLVGIDTPSLDPQHSKTLDAHHA 163 Pseudomonas aer...
WP_011059116  86 cLDSGALVQPEALLGRLENLPARVLLRTYPQAPLSaWDPDFTAVAPATVELLASLGVRLIGIDTPSLDPQQSKTMDAHNT 165 fluorescent pse...
WP_011000714  84 cVGVAR-VEPEHVRDALDGAPPRVLLRTYARMPQNaWDDHFAAVAPETIGLLAAHGVRLIGTDTASLDPQTSKTMDAHHA 162 Ralstonia solan...
WP_011245507  89 -LSKYEKIDKAALRSLHLEGVKRLLIKTAVPNQATaFPENIPYVTPDGAAYMKEKGIILIGVDVPSVDPLDSKELEGHHA 167 Bacillus clausii
WP_011065163  83 -LSAFDEIDETALKSKVKEDTERLLIRTSLPNNPEqFPTDVTPITSDGAAYMHFLGVKLVGVDTPSVDPLSSKELVGHHA 161 Oceanobacillus ...
WP_004534233 112 cIGARSAVTPEHVRAALAGAPPRVLLRTYGQAPQHaWDSAFCAVAPETIDLLAAHGVRLVGIDTPSLDPQESKTMDAHRR 191 Burkholderia ps...
WP_003810518  83 aIGCGPLILPEHLAHAQAGLPPRVLVRTARHAALQwWVDDFSAYAPQTIEWLAGRGVTLIGIDTPSIDPASSKTLDSHHA 162 Bordetella
4COB_A        87 cIGANPLVTPEHLAGQLDDLPSRVLLRTFERVPAN-WPEGFCAIAPATIECLAERGVRLVGIDTPSLDPQHSKTLDAHHA 165 Pseudomonas aer...
4CZ1_A       164 LFKHSIHILENVVLDHVADGDYELIALPLALSDADGSPVRAVIRPI 209 Bacillus anthracis str. Ames
WP_003114853 164 VGRHGMAILEGVVLDDVPAGDYELLALPLKFTHLDASPVRAVLRAL 209 Pseudomonas aeruginosa
WP_011059116 166 VARHGMAILEGVVLDEVAEGDYELIALPLRFAHLDASPVRAILRPL 211 fluorescent pseudomonads
WP_011000714 163 VGRHGLAILEGLVLDDVPAGDYELIALPLKFATLDASPVRAVLRRL 208 Ralstonia solanacearum
WP_011245507 168 LADNGISILENLMLDKVKEGDYELIALPLPMEEADGSPVRAVIRAI 213 Bacillus clausii
WP_011065163 162 LFKHDINILENVMLDQVVEGDYEMIALPLPLQDADGSLVRAVIKPI 207 Oceanobacillus iheyensis
WP_004534233 192 IRAHRMAILEGLVLDEIAAGDYELIALPLKFTTLDASPVRAVLRAL 237 Burkholderia pseudomallei
WP_003810518 163 IRRHDMRVLENLRLDDVDEGDYELIALPLALVQADASPVRAVLREL 208 Bordetella
4COB_A       166 VGRHGMAILEGVVLDDVPAGDYELLALPLKFTHLDASPVRAVLRAL 211 Pseudomonas aeruginosa PAO1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap