Conserved Protein Domain Family

TIGR03034: TIGR03034 
conserved hypothetical protein
Members of this protein family have been found in several species of gammaproteobacteria, including Yersinia pestis and Y. pseudotuberculosis, Xylella fastidiosa, and Escherichia coli UTI89. As many as five members can be found in a single genome. The function is unknown. [Hypothetical proteins, Conserved]
PSSM-Id: 132079
Aligned: 4 rows
Threshold Bit Score: 427.309
Threshold Setting Gi: 446989147
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_011193276 251 YRQFRIFHIWFVLQRWKGLGYKPFLTNMEATLEITG 286 Yersinia pseudotuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap