Conserved Protein Domain Family
TIGR03034

?
TIGR03034: TIGR03034 
conserved hypothetical protein
Members of this protein family have been found in several species of gammaproteobacteria, including Yersinia pestis and Y. pseudotuberculosis, Xylella fastidiosa, and Escherichia coli UTI89. As many as five members can be found in a single genome. The function is unknown. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 132079
View PSSM: TIGR03034
Aligned: 4 rows
Threshold Bit Score: 427.309
Threshold Setting Gi: 446989147
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_016581889  11 ALYFPCTVFKTQKRMDDYGADDMRCGDLSATQLKTDFNLHNISSKVNPYTltlfQQLKPMPYGYAYDKNPESKKITRQEC 90  Yersinia pestis
WP_011193276  17 PLQFPLCIFKTRNRMDDYGAADMKNGDLTEAELKGKFNLRGVSVTLDPYT----GEKTPTSFAMDHFNKKPKEKVNKAEV 92  Yersinia pseudo...
WP_010892700  29 SLDFPFVAFRSELPMNDYSAPDMKCGDLTKEQLIHDFGLSFVSFHVNPFN------------NEEGFIKGKSKIISDEEV 96  Xylella fastidiosa
WP_001066403   8 SINIPCTLFETISLFDNYSADDMQYGDMVEQDFLS-LGLSDISAKVDPYRlikyHFPGPGSINVAFSASSSGTKISQREC 86  Escherichia coli
WP_016581889  91 VRILFNEFRHESRSFAFYGPYKHLIEKMIDHMQNGNGTPFRDLSLDAALKEQILSDYTEKNSTRlLLRKVLNENIDWRNK 170 Yersinia pestis
WP_011193276  93 ARVLFDEFRHLSDTFSFSGKYQSIMRKMITHMQINNGAPFRDLLLDSALKEQILSDKSKKSSLV-IIQSILEKTINWKEG 171 Yersinia pseudo...
WP_010892700  97 VIILFNEFRFWARVLSF-GRYSSLMQSLISNFQDNKGTPFSDPLLDKAFKELILNERSENGSIS-RIKSVFDNCIDWERG 174 Xylella fastidiosa
WP_001066403  87 TDILFAEMKELAKMFSFFGQYKTLIEDLIEHFRYGNGSNFHSQQLNLSFHEKI-NKYGYNSPIR-IIKECIENGINSTPS 164 Escherichia coli
WP_016581889 171 L-YPAEKKDDIRKFILDGRLPKFDRFQDNFNGMGITVHDTWATDITIKSLQIDNDRYRAMVHYKIQDHFGLDNNDIKNTK 249 Yersinia pestis
WP_011193276 172 H-YSSNDESILSDAVKKSILPRFNRWKDRANGLGITVHAIHATHITIKSLKIDGDMFHATVHYRSQDHFGLDDTDVLDPF 250 Yersinia pseudo...
WP_010892700 175 V-FPSENKEYLIETLKSAIYPEFTRVQDTFNGLGLAVHNINSMNIEINSCNIYDDHYCASVHYQGQDHFGLDDGDIIDIR 253 Xylella fastidiosa
WP_001066403 165 TgYQPLILQSIKTKLLSSRLNKFNDFEDSFNGLGISVHDISAQKISLLSFQKYAIGWSATIHFVAQDHFGLDVTDIKNKT 244 Escherichia coli
WP_016581889 250 FNRFHFFRIWFVLQRFNQFGFKPFMTNMEATIEITG 285 Yersinia pestis
WP_011193276 251 YRQFRIFHIWFVLQRWKGLGYKPFLTNMEATLEITG 286 Yersinia pseudotuberculosis
WP_010892700 254 FHYFSIFRIWFVLQRWNRYAFRPFMTNMRANIEISG 289 Xylella fastidiosa
WP_001066403 245 YSKYRFFRIWFFLQRHKDFAFKPFFTNFNTIERIEN 280 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap