Conserved Protein Domain Family
EpsG

?
TIGR03029: EpsG 
chain length determinant protein tyrosine kinase EpsG
The proteins in this family are homologs of the EpsG protein found in Methylobacillus strain 12S and are generally found in operons with other Eps homologs. The protein is believed to function as the protein tyrosine kinase component of the chain length regulator (along with the transmembrane component EpsF).
Statistics
?
PSSM-Id: 132074
View PSSM: TIGR03029
Aligned: 3 rows
Threshold Bit Score: 452.78
Threshold Setting Gi: 499261979
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC55137      19 NDANIGKVLLDLGKLTPDEAERVLRLQKQENIRFGEAALRLGFINESDIRQALSVQFEYPYLQPNEGGFSPDLVAAYQPF 98  Methylobacillus...
WP_011379606  33 NSSSIGAILVNAGRLSEENVTRILEAQVQQQNHFGEAAICLGLLTEDDVRFALSRQFNNLYLPAGDSSLSHHLIAAYKPF 112 Nitrosospira mu...
WP_010959519  15 SDVQLGQLLLHAGKLSEKDIEAIGVKQKEDGLRFGEAALRLGLIGEDDLRQALARQFAHPCLPESDTSVDAELIAAFCPP 94  Methylococcus c...
BAC55137      99 SKQVEALRALRTQLILRWF--SEGNKALAVVAAKSGDGCSYIAANLAIVFSQLGEKTLLIDGNLRDPVQHRNFNLSEQRG 176 Methylobacillus...
WP_011379606 113 SPVVEHLRSLRSQLMLRWFepDTDRNVLAIVSPGLGEGRSFIAANLAIVFSQLGKSTLLIDANLRAPRQQEFFKVNTGGG 192 Nitrosospira mu...
WP_010959519  95 GPEGEALRDLRSILMLRWF--GGHRRLLALTSGRPGEGCGRLAANLAVVFSQLGERILLIDANLREPELHRLFKLCGDPG 172 Methylococcus c...
BAC55137     177 LSDILIGR-SDLEVITHLGAFENLSVLGAGTIPPNPQELLARPAFTDLMNKVMGDYDVIIVDTSSTEHSSDAQSVASRCR 255 Methylobacillus...
WP_011379606 193 LSSYLAGR-AGLESIVRIPSLLGLSVLPAGAVPPNPQELIGRPVFADLLQSVGCEFDVVIVDTPSASEYGEAQIIATEAS 271 Nitrosospira mu...
WP_010959519 173 LSGVLAGRhSPEKAISSIPALGDLSVLPAGAPPPNPQELLSRASFIRLLDAAAEQYDIVLLNTPPALQSADARIVATRAA 252 Methylococcus c...
BAC55137     256 GTLAISRVNETRMHELTSLKEHLSGVGVRIVGAVANQ 292 Methylobacillus sp. 12S
WP_011379606 272 AALIVLRKNHTSLSRTVDLARRFQQTGAAVVGSVLND 308 Nitrosospira multiformis
WP_010959519 253 GCIIVVRRDATRLGDAAALRDQLSGAGVEVLGAVLTS 289 Methylococcus capsulatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap